Project name: 7911ee5937658c4

Status: done

submitted: 2017-11-14 10:16:24, status changed: 2017-11-14 11:43:18
Settings
Chain sequence(s) A: EIVLTQSPGTLSLSPGERATLSCIILMLAGGLAILWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: EIVLTQSPGTLSLSPGERATLSCIILMLAGGLAILWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9523
Maximal score value
2.3206
Average score
-0.7721
Total score value
-1023.7983

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.5438
2 I A 1.3900
3 V A 0.0000
4 L A 0.9079
5 T A 0.0000
6 Q A -0.8776
7 S A -0.7974
8 P A 0.0000
9 G A -1.0641
10 T A -0.6417
11 L A -0.1942
12 S A -0.6889
13 L A -1.3311
14 S A -1.8504
15 P A -2.1844
16 G A -2.5435
17 E A -3.0253
18 R A -3.1838
19 A A 0.0000
20 T A -0.8665
21 L A 0.0000
22 S A -0.3793
23 C A 0.0000
24 I A 1.0230
25 I A 0.0000
26 L A 2.0697
27 M A 1.7534
28 L A 1.6027
29 A A 0.4206
30 G A -0.0406
31 G A -0.1013
32 L A 0.3787
33 A A 0.0000
34 I A 0.0000
35 L A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A 0.0000
39 Q A -1.1667
40 K A -1.8096
41 P A -1.2765
42 G A -1.2259
43 Q A -1.6697
44 A A -1.2635
45 P A 0.0000
46 R A -1.4534
47 L A -0.5394
48 L A 0.0000
49 I A 0.0000
50 Y A 0.6733
51 G A 0.3886
52 A A 0.1626
53 F A 0.4343
54 S A 0.0507
55 R A -0.6333
56 A A -0.3432
57 T A -0.3600
58 G A -0.6509
59 I A -0.6181
60 P A -1.3065
61 D A -2.0364
62 R A -1.7727
63 F A 0.0000
64 S A -0.4905
65 G A 0.0000
66 S A -0.3179
67 G A -0.6416
68 S A -0.4771
69 G A 0.3645
70 T A 0.3377
71 D A -0.6325
72 F A 0.0000
73 T A -0.3854
74 L A 0.0000
75 T A -0.7377
76 I A 0.0000
77 S A -2.4954
78 R A -3.3958
79 L A 0.0000
80 E A -2.1050
81 P A -1.9576
82 E A -2.3330
83 D A 0.0000
84 F A 0.0000
85 A A 0.0000
86 V A -0.5541
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 Q A 0.0000
91 Q A 0.0000
92 Y A -0.0967
93 G A -0.3018
94 S A -0.6736
95 S A -0.4565
96 P A -0.8091
97 W A 0.0000
98 T A -0.5497
99 F A 0.0000
100 G A 0.0000
101 Q A -1.5665
102 G A 0.0000
103 T A 0.0000
104 K A -1.1439
105 V A 0.0000
106 E A -1.0595
107 I A 0.0000
108 K A -1.4727
109 R A -1.2255
110 T A 0.0742
111 V A 1.1006
112 A A 0.4349
113 A A 0.0912
114 P A -0.0056
115 S A -0.3282
116 V A 0.0000
117 F A 0.1101
118 I A 0.0000
119 F A 0.0000
120 P A -0.4385
121 P A 0.0000
122 S A -1.7894
123 D A -3.2253
124 E A -3.1701
125 Q A 0.0000
126 L A -2.0445
127 K A -2.8823
128 S A -1.7324
129 G A -1.1120
130 T A -0.6261
131 A A 0.0000
132 S A 0.0000
133 V A 0.0000
134 V A 0.0000
135 C A 0.0000
136 L A 0.0000
137 L A 0.0000
138 N A 0.0000
139 N A -0.9083
140 F A 0.0000
141 Y A 0.0000
142 P A -1.6855
143 R A -3.1775
144 E A -3.3100
145 A A -2.5194
146 K A -2.5510
147 V A -1.3956
148 Q A -1.2734
149 W A 0.0000
150 K A -0.8427
151 V A 0.0000
152 D A -1.7446
153 N A -1.3974
154 A A -0.5291
155 L A 0.0351
156 Q A -1.2212
157 S A -0.9420
158 G A -1.3095
159 N A -1.9172
160 S A -1.6414
161 Q A -1.4154
162 E A -1.9190
163 S A 0.0000
164 V A -0.6846
165 T A -1.1123
166 E A -2.2154
167 Q A 0.0000
168 D A -2.2645
169 S A -2.2548
170 K A -2.5267
171 D A -2.3270
172 S A -2.2112
173 T A 0.0000
174 Y A 0.0000
175 S A 0.0000
176 L A -0.6921
177 S A 0.0000
178 S A 0.0000
179 T A 0.0000
180 L A 0.0000
181 T A -0.5401
182 L A -0.4876
183 S A -0.7237
184 K A -1.2300
185 A A -1.2734
186 D A -1.4451
187 Y A 0.0000
188 E A -2.1006
189 K A -2.8486
190 H A -2.5201
191 K A -2.8111
192 V A -1.3915
193 Y A 0.0000
194 A A -1.0876
195 C A 0.0000
196 E A -1.2724
197 V A 0.0000
198 T A -1.2287
199 H A 0.0000
200 Q A -1.7736
201 G A -0.3994
202 L A -0.0873
203 S A -0.4103
204 S A -0.3323
205 P A -0.5236
206 V A -0.1214
207 T A -0.6864
208 K A -1.0230
209 S A -0.8149
210 F A -1.1566
211 N A -1.8950
212 R A -2.0448
213 G A -1.5811
214 E A -1.9599
215 C A -1.5661
216 Q B -1.4142
217 V B -0.9615
218 Q B -1.3974
219 L B 0.0000
220 V B -0.2865
221 E B -0.2621
222 S B -0.6084
223 G B -0.7317
224 G B -0.2988
225 G B 0.3713
226 V B 0.5572
227 V B -0.6172
228 Q B -1.8823
229 P B -2.1817
230 G B -2.3529
231 R B -2.8326
232 S B -2.0698
233 L B -1.5426
234 R B -2.1311
235 L B 0.0000
236 S B -0.6659
237 C B 0.0000
238 A B -0.4322
239 A B -0.6334
240 S B -0.9205
241 G B -0.8497
242 F B -0.1413
243 T B -0.0803
244 F B 0.0000
245 S B -0.4687
246 S B 0.1395
247 Y B 0.6843
248 T B 0.3156
249 M B 0.0000
250 H B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B 0.0000
254 Q B -0.9908
255 A B -1.1906
256 P B -1.0580
257 G B -1.4709
258 K B -2.5479
259 G B -1.9040
260 L B 0.0000
261 E B -2.1136
262 W B 0.0000
263 V B 0.0000
264 T B 0.0000
265 F B 0.0000
266 I B 0.0000
267 S B -0.5878
268 Y B 0.1024
269 D B -1.4375
270 G B -1.7215
271 N B -2.2322
272 N B -2.0940
273 K B -1.1165
274 Y B -0.2233
275 Y B -0.8023
276 A B -1.4866
277 D B -2.6068
278 S B -2.1075
279 V B 0.0000
280 K B -2.6978
281 G B -1.9846
282 R B -2.1708
283 F B 0.0000
284 T B -1.0969
285 I B 0.0000
286 S B -0.4324
287 R B -0.8467
288 D B -1.3985
289 N B -1.4796
290 S B -1.5503
291 K B -2.3368
292 N B -1.7048
293 T B -0.9882
294 L B 0.0000
295 Y B -0.4589
296 L B 0.0000
297 Q B -1.5130
298 M B 0.0000
299 N B -2.1322
300 S B -1.9244
301 L B 0.0000
302 R B -3.1949
303 A B -2.0588
304 E B -2.4977
305 D B 0.0000
306 T B -0.5228
307 A B 0.0000
308 I B 0.6937
309 Y B 0.0000
310 Y B 0.0000
311 C B 0.0000
312 A B 0.0000
313 R B 0.0000
314 T B 0.0000
315 G B 0.6149
316 W B 1.6749
317 L B 1.6333
318 G B 0.0000
319 P B 0.0000
320 F B 0.0000
321 D B -0.3375
322 Y B -0.3791
323 W B 0.0000
324 G B 0.0000
325 Q B -1.2307
326 G B -0.3669
327 T B 0.3009
328 L B 1.2408
329 V B 0.0000
330 T B 0.1482
331 V B 0.0000
332 S B -0.8240
333 S B -0.6181
334 A B -0.5922
335 S B -0.9069
336 T B -1.2065
337 K B -2.2862
338 G B -2.0450
339 P B -1.1096
340 S B -0.6894
341 V B -0.4756
342 F B -0.7361
343 P B -1.3269
344 L B 0.0000
345 A B -0.9682
346 P B -0.7773
347 S B -1.1569
348 S B -1.3471
349 K B -1.8242
350 S B -1.3819
351 T B -0.9543
352 S B -0.9682
353 G B -0.7742
354 G B -0.7088
355 T B -0.5159
356 A B 0.0000
357 A B 0.0161
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.6519
364 D B -1.3125
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.6500
369 P B -0.7176
370 V B -0.5657
371 T B -0.6160
372 V B 0.0040
373 S B -0.3894
374 W B 0.0000
375 N B -0.8519
376 S B -0.6617
377 G B -0.5351
378 A B -0.2168
379 L B -0.0029
380 T B -0.1436
381 S B -0.1404
382 G B -0.2091
383 V B 0.2305
384 H B -0.1487
385 T B 0.0426
386 F B 0.0000
387 P B -0.2310
388 A B 0.4144
389 V B 0.7043
390 L B 1.3205
391 Q B 0.1348
392 S B -0.1355
393 S B -0.4370
394 G B -0.1312
395 L B -0.1282
396 Y B 0.0355
397 S B -0.0412
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0972
404 V B 0.0000
405 P B -0.5677
406 S B -0.5952
407 S B -0.6755
408 S B -0.8060
409 L B -0.9204
410 G B -1.1849
411 T B -0.9220
412 Q B -1.3891
413 T B -1.3675
414 Y B 0.0000
415 I B -1.4966
416 C B 0.0000
417 N B -1.6204
418 V B 0.0000
419 N B -2.1185
420 H B 0.0000
421 K B -2.7607
422 P B -1.7319
423 S B -2.0330
424 N B -2.5634
425 T B -2.1785
426 K B -2.6904
427 V B -1.7771
428 D B -2.7050
429 K B -2.3117
430 R B -2.9470
431 V B 0.0000
432 E B -2.9639
433 P B -2.2493
434 K B -2.6862
435 S B -1.4936
436 C B -1.1176
437 D B -1.3226
438 K B -1.2973
439 T B -1.4335
440 H B -1.3013
441 T B -0.9463
442 C B -0.8094
443 P B -0.8974
444 P B -0.9305
445 C B -0.7524
446 P B -0.7993
447 A B -0.7134
448 P B -0.5437
449 E B -0.5339
450 L B 1.2805
451 L B 1.5807
452 G B 0.3829
453 G B -0.1186
454 P B -0.4682
455 S B 0.2357
456 V B 0.0000
457 F B 2.3206
458 L B 1.7498
459 F B 2.1489
460 P B 0.2219
461 P B 0.0000
462 K B -1.9891
463 P B -1.2645
464 K B -1.1654
465 D B -1.4110
466 T B 0.0000
467 L B 0.0000
468 M B 0.5860
469 I B 1.5839
470 S B -0.0497
471 R B -1.3611
472 T B -0.5939
473 P B 0.0000
474 E B -1.2046
475 V B 0.0000
476 T B 0.9942
477 C B 0.0000
478 V B 0.8974
479 V B 0.0000
480 V B -0.0987
481 D B -1.3268
482 V B 0.0000
483 S B -1.8770
484 H B -2.1521
485 E B -2.8504
486 D B -2.3428
487 P B -2.2951
488 E B -2.5777
489 V B 0.0000
490 K B -2.6450
491 F B 0.0000
492 N B -1.5288
493 W B 0.0000
494 Y B -0.8384
495 V B -0.6386
496 D B -1.9731
497 G B -0.6036
498 V B 1.0058
499 E B -0.0464
500 V B 0.9450
501 H B -0.8717
502 N B -0.9803
503 A B -0.9309
504 K B -2.2334
505 T B -1.2770
506 K B -1.7823
507 P B -1.5731
508 R B -2.4945
509 E B -2.5551
510 E B -2.8436
511 Q B -2.1793
512 Y B -0.7376
513 N B -1.1633
514 S B -1.1628
515 T B -1.3653
516 Y B -1.9302
517 R B -1.7241
518 V B 0.0000
519 V B -0.4703
520 S B 0.0000
521 V B 0.0320
522 L B 0.0000
523 T B -0.4328
524 V B 0.4335
525 L B 1.1236
526 H B 0.0000
527 Q B -0.9540
528 D B -0.9140
529 W B 0.0000
530 L B -0.7639
531 N B -1.9105
532 G B -2.0304
533 K B -2.1654
534 E B -2.2269
535 Y B 0.0000
536 K B -1.7685
537 C B 0.0000
538 K B -1.7814
539 V B 0.0000
540 S B -1.4780
541 N B -1.8488
542 K B -2.1074
543 A B -1.2733
544 L B -0.5964
545 P B -0.4371
546 A B -0.3600
547 P B -0.5424
548 I B -0.5630
549 E B -1.4468
550 K B -1.2140
551 T B -1.0160
552 I B 0.0525
553 S B -1.7002
554 K B -1.9241
555 A B -1.5692
556 K B -2.5099
557 G B -2.2027
558 Q B -2.2129
559 P B -2.2936
560 R B -2.9210
561 E B -2.6882
562 P B 0.0000
563 Q B -1.4083
564 V B 0.0000
565 Y B 0.0000
566 T B -0.7655
567 L B 0.0000
568 P B -0.3929
569 P B 0.0000
570 S B -1.1088
571 R B -2.1564
572 D B -1.8838
573 E B 0.0000
574 L B -1.1875
575 T B -1.4172
576 K B -2.4762
577 N B -2.7492
578 Q B -2.7399
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B -0.6065
587 G B -1.0927
588 F B 0.0000
589 Y B -1.3323
590 P B 0.0000
591 S B 0.0641
592 D B -0.8742
593 I B 0.0000
594 A B 0.0000
595 V B -0.4302
596 E B -1.3335
597 W B 0.0000
598 E B -2.0938
599 S B 0.0000
600 N B -2.2445
601 G B -1.8996
602 Q B -2.2937
603 P B -2.1802
604 E B -2.4962
605 N B -2.0434
606 N B -1.3072
607 Y B -0.8178
608 K B -0.3685
609 T B -0.2522
610 T B 0.0000
611 P B 0.0576
612 P B 0.3177
613 V B 0.8858
614 L B 1.1502
615 D B -0.2086
616 S B -1.1657
617 D B -1.8803
618 G B -0.7128
619 S B 0.0000
620 F B 0.2167
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.7795
628 V B -1.4300
629 D B -2.7721
630 K B -2.7610
631 S B -2.5044
632 R B -3.3010
633 W B -2.3931
634 Q B -2.5501
635 Q B -2.6238
636 G B -1.6255
637 N B -1.5104
638 V B -0.6240
639 F B 0.0000
640 S B -1.2490
641 C B 0.0000
642 S B -0.8887
643 V B 0.0000
644 M B -0.6233
645 H B 0.0000
646 E B -1.1831
647 A B -1.8667
648 L B 0.0000
649 H B -1.7959
650 N B -1.7489
651 H B -1.2269
652 Y B -0.6704
653 T B -1.1223
654 Q B -1.4540
655 K B -1.1771
656 S B -0.4376
657 L B 0.2039
658 S B 0.1424
659 L B 0.7929
660 S B 0.2748
661 P B -0.3444
662 G B -0.4886
663 K B -0.8914
664 E C -0.6468
665 I C 1.2046
666 V C 0.0000
667 L C 1.1927
668 T C 0.0000
669 Q C -0.9419
670 S C -0.8041
671 P C -0.8927
672 G C -0.9399
673 T C -0.5399
674 L C -0.2847
675 S C -0.6335
676 L C -1.4691
677 S C -1.9372
678 P C -2.2339
679 G C -2.6976
680 E C -3.1788
681 R C -3.3014
682 A C 0.0000
683 T C -0.9442
684 L C 0.0000
685 S C -0.3546
686 C C 0.0000
687 I C 1.1477
688 I C 0.0000
689 L C 2.3148
690 M C 2.1434
691 L C 1.8074
692 A C 0.8339
693 G C 0.1822
694 G C 0.1404
695 L C 0.7185
696 A C 0.0000
697 I C 0.0000
698 L C 0.0000
699 W C 0.0000
700 Y C 0.0000
701 Q C 0.0000
702 Q C -1.2260
703 K C -1.7837
704 P C -1.2486
705 G C -1.3068
706 Q C -1.4915
707 A C -1.2439
708 P C 0.0000
709 R C -2.0318
710 L C 0.0000
711 L C 0.0000
712 I C 0.0000
713 Y C 0.3828
714 G C 0.3979
715 A C 0.0902
716 F C 0.0966
717 S C -0.4466
718 R C -1.5009
719 A C -0.9101
720 T C -0.5880
721 G C -0.8359
722 I C -0.8498
723 P C -1.4422
724 D C -2.1386
725 R C -1.7954
726 F C 0.0000
727 S C -0.7340
728 G C -0.1868
729 S C -0.3558
730 G C -0.6400
731 S C -0.3755
732 G C 0.5661
733 T C 0.5333
734 D C -0.2853
735 F C 0.0000
736 T C -0.3996
737 L C 0.0000
738 T C -0.7797
739 I C 0.0000
740 S C -2.6396
741 R C -3.5633
742 L C 0.0000
743 E C -2.4689
744 P C -2.0378
745 E C -2.4280
746 D C 0.0000
747 F C 0.0000
748 A C 0.0000
749 V C -0.3114
750 Y C 0.0000
751 Y C 0.0000
752 C C 0.0000
753 Q C 0.0000
754 Q C 0.0000
755 Y C -0.0661
756 G C -0.3126
757 S C -0.7449
758 S C -0.5231
759 P C -0.7638
760 W C 0.0000
761 T C -0.5153
762 F C 0.0000
763 G C 0.0000
764 Q C -1.4368
765 G C -1.0147
766 T C 0.0000
767 K C -0.7951
768 V C 0.0000
769 E C -0.9689
770 I C 0.0000
771 K C -1.4467
772 R C -1.4111
773 T C -0.0327
774 V C 1.0556
775 A C 0.4207
776 A C 0.1316
777 P C -0.1598
778 S C -0.2679
779 V C 0.0000
780 F C 0.1308
781 I C 0.0000
782 F C 0.0000
783 P C 0.0000
784 P C 0.0000
785 S C 0.0000
786 D C -2.5129
787 E C -2.0077
788 Q C 0.0000
789 L C -1.9291
790 K C -2.4997
791 S C -1.5490
792 G C -1.1417
793 T C -0.8728
794 A C 0.0000
795 S C 0.0000
796 V C 0.0000
797 V C 0.0000
798 C C 0.0000
799 L C 0.0000
800 L C 0.0000
801 N C 0.0000
802 N C -0.7808
803 F C 0.0000
804 Y C 0.0000
805 P C -1.7217
806 R C -3.1845
807 E C -3.3020
808 A C -2.5028
809 K C -2.6839
810 V C -1.3672
811 Q C -1.2857
812 W C 0.0000
813 K C -0.7053
814 V C -0.8970
815 D C -1.4848
816 N C -1.2837
817 A C -0.3842
818 L C 0.3240
819 Q C -1.0981
820 S C -0.8784
821 G C -1.2724
822 N C -1.9436
823 S C -1.5745
824 Q C -1.1834
825 E C -1.9556
826 S C 0.0000
827 V C -0.7028
828 T C -1.0583
829 E C -2.2789
830 Q C 0.0000
831 D C -2.2050
832 S C -2.3002
833 K C -2.4233
834 D C -2.1467
835 S C 0.0000
836 T C -1.6155
837 Y C 0.0000
838 S C 0.0000
839 L C -0.6380
840 S C 0.0000
841 S C 0.0000
842 T C 0.0000
843 L C 0.0000
844 T C -0.4967
845 L C -0.6885
846 S C -1.3513
847 K C -2.1725
848 A C -2.3383
849 D C -3.0417
850 Y C 0.0000
851 E C -3.9523
852 K C -3.7644
853 H C -3.1477
854 K C -3.1933
855 V C -1.4334
856 Y C 0.0000
857 A C -0.8616
858 C C 0.0000
859 E C -1.1196
860 V C 0.0000
861 T C -1.1681
862 H C 0.0000
863 Q C -1.7724
864 G C -0.3805
865 L C -0.0570
866 S C -0.3981
867 S C -0.3049
868 P C -0.4562
869 V C 0.1314
870 T C -0.3852
871 K C -0.4870
872 S C -0.6222
873 F C 0.0000
874 N C -1.9546
875 R C -2.4614
876 G C -1.7627
877 E C -1.4449
878 C C -0.5220
879 Q D -1.2573
880 V D -0.5438
881 Q D -1.0391
882 L D 0.0000
883 V D 0.2464
884 E D 0.0000
885 S D -0.4632
886 G D -0.6848
887 G D -0.3013
888 G D 0.1824
889 V D 0.2973
890 V D 0.0000
891 Q D -2.0203
892 P D -2.2314
893 G D -2.3288
894 R D -2.6874
895 S D -1.8206
896 L D -0.9756
897 R D -1.8742
898 L D 0.0000
899 S D -0.6158
900 C D 0.0000
901 A D -0.2744
902 A D 0.0000
903 S D -0.7857
904 G D -0.6861
905 F D -0.0607
906 T D -0.0413
907 F D 0.0000
908 S D -0.9757
909 S D -0.3175
910 Y D 0.1813
911 T D 0.0000
912 M D 0.0000
913 H D 0.0000
914 W D 0.0000
915 V D 0.0000
916 R D 0.0000
917 Q D -0.9556
918 A D -1.2224
919 P D -1.0825
920 G D -1.4810
921 K D -2.5100
922 G D -1.8465
923 L D -1.2504
924 E D -1.6295
925 W D 0.0000
926 V D 0.0000
927 T D 0.0000
928 F D 0.1623
929 I D 0.0000
930 S D -1.1005
931 Y D -1.1055
932 D D -2.4267
933 G D -2.1590
934 N D -2.3604
935 N D -1.8626
936 K D -0.8368
937 Y D 0.2784
938 Y D -0.6059
939 A D -1.3295
940 D D -2.7025
941 S D -2.2545
942 V D 0.0000
943 K D -2.9767
944 G D -2.3982
945 R D -3.1312
946 F D 0.0000
947 T D -1.3213
948 I D 0.0000
949 S D -0.6550
950 R D -1.1146
951 D D -1.7816
952 N D -1.7868
953 S D -1.5851
954 K D -2.4153
955 N D -1.7857
956 T D -1.0204
957 L D 0.0000
958 Y D -0.5345
959 L D 0.0000
960 Q D -1.5388
961 M D 0.0000
962 N D -2.1500
963 S D -2.0740
964 L D 0.0000
965 R D -3.2806
966 A D -2.0877
967 E D -2.4914
968 D D 0.0000
969 T D -0.6569
970 A D 0.0000
971 I D 0.4763
972 Y D 0.0000
973 Y D 0.0000
974 C D 0.0000
975 A D 0.0000
976 R D 0.1793
977 T D 0.0000
978 G D 0.0000
979 W D 1.9539
980 L D 2.0994
981 G D 1.0447
982 P D 0.0000
983 F D 0.0000
984 D D -0.0904
985 Y D -0.1062
986 W D 0.0000
987 G D 0.0000
988 Q D -0.9710
989 G D 0.0000
990 T D 0.1780
991 L D 0.6850
992 V D 0.0000
993 T D -0.1101
994 V D 0.0000
995 S D -0.9376
996 S D -0.7176
997 A D -0.6331
998 S D -0.8701
999 T D -1.0587
1000 K D -1.9324
1001 G D -1.6119
1002 P D -0.7620
1003 S D -0.3853
1004 V D 0.0000
1005 F D -0.5842
1006 P D -1.2266
1007 L D 0.0000
1008 A D 0.0000
1009 P D -0.7031
1010 S D 0.0000
1011 S D -1.1912
1012 K D -2.0186
1013 S D -1.2469
1014 T D -0.9723
1015 S D -0.8808
1016 G D -0.7708
1017 G D -0.6971
1018 T D -0.5199
1019 A D 0.0000
1020 A D 0.0000
1021 L D 0.0000
1022 G D 0.0000
1023 C D 0.0000
1024 L D 0.0000
1025 V D 0.0000
1026 K D -0.3301
1027 D D -0.6152
1028 Y D 0.0000
1029 F D 0.0000
1030 P D 0.0000
1031 E D -0.8196
1032 P D -0.8588
1033 V D -0.5471
1034 T D -0.5644
1035 V D -0.0615
1036 S D -0.2265
1037 W D 0.0000
1038 N D -0.6783
1039 S D -0.5312
1040 G D -0.3962
1041 A D -0.1326
1042 L D 0.1166
1043 T D -0.0497
1044 S D -0.0772
1045 G D -0.0804
1046 V D 0.3735
1047 H D -0.0358
1048 T D 0.1069
1049 F D 0.0000
1050 P D -0.2050
1051 A D 0.2576
1052 V D 0.6923
1053 L D 1.3914
1054 Q D 0.0511
1055 S D -0.1066
1056 S D -0.3617
1057 G D -0.0346
1058 L D 0.0361
1059 Y D 0.2515
1060 S D 0.0000
1061 L D 0.1256
1062 S D 0.0000
1063 S D 0.0000
1064 V D 0.0000
1065 V D 0.0000
1066 T D -0.0388
1067 V D 0.0000
1068 P D -0.5847
1069 S D -0.6191
1070 S D -0.6927
1071 S D -0.8250
1072 L D 0.0000
1073 G D -1.2469
1074 T D -0.9302
1075 Q D -1.3579
1076 T D -1.3684
1077 Y D 0.0000
1078 I D -1.3034
1079 C D 0.0000
1080 N D -1.3429
1081 V D 0.0000
1082 N D -1.8977
1083 H D 0.0000
1084 K D -2.7536
1085 P D -1.7598
1086 S D -1.9745
1087 N D -2.5416
1088 T D -2.0700
1089 K D -2.5371
1090 V D -1.3587
1091 D D -2.0224
1092 K D -2.1074
1093 R D -2.8628
1094 V D 0.0000
1095 E D -2.7036
1096 P D -1.6391
1097 K D -1.5727
1098 S D -1.5656
1099 C D -1.1621
1100 D D -1.9916
1101 K D -2.3715
1102 T D -1.6572
1103 H D -1.7191
1104 T D -1.3782
1105 C D 0.0000
1106 P D -1.5001
1107 P D -1.2424
1108 C D -0.6627
1109 P D -0.7264
1110 A D -0.9109
1111 P D -1.1492
1112 E D -1.3094
1113 L D 0.0868
1114 L D 1.1911
1115 G D 0.0005
1116 G D -0.1021
1117 P D -0.1318
1118 S D 0.0207
1119 V D 0.0000
1120 F D 1.2594
1121 L D 0.8570
1122 F D 1.0897
1123 P D -0.0590
1124 P D 0.0000
1125 K D -2.0927
1126 P D -1.2944
1127 K D -1.0398
1128 D D -1.3197
1129 T D 0.0000
1130 L D 0.0000
1131 M D 0.6259
1132 I D 1.4447
1133 S D -0.0470
1134 R D -1.3224
1135 T D -0.7440
1136 P D 0.0000
1137 E D -1.2898
1138 V D 0.0000
1139 T D 0.5318
1140 C D 0.0000
1141 V D 0.0000
1142 V D 0.0000
1143 V D 0.0727
1144 D D -0.2847
1145 V D 0.0000
1146 S D -1.8126
1147 H D -2.3892
1148 E D -2.8531
1149 D D -2.3383
1150 P D -2.3562
1151 E D -2.7192
1152 V D 0.0000
1153 K D -2.5156
1154 F D -2.0260
1155 N D -1.5188
1156 W D 0.0000
1157 Y D -1.0222
1158 V D -0.8143
1159 D D -2.0367
1160 G D -0.6747
1161 V D 0.9386
1162 E D -0.1772
1163 V D 0.2356
1164 H D -1.2071
1165 N D -1.2768
1166 A D -1.3004
1167 K D -2.3553
1168 T D -1.9154
1169 K D -3.1850
1170 P D -2.4969
1171 R D -3.0615
1172 E D -2.9363
1173 E D -1.9186
1174 Q D -1.3010
1175 Y D -0.4778
1176 N D -1.0282
1177 S D -0.7423
1178 T D -0.7391
1179 Y D -1.3439
1180 R D -1.6100
1181 V D 0.0000
1182 V D -1.0871
1183 S D 0.0000
1184 V D -0.3564
1185 L D 0.0000
1186 T D -0.4591
1187 V D 0.2959
1188 L D 0.8763
1189 H D 0.0000
1190 Q D -1.1280
1191 D D -1.2641
1192 W D 0.0000
1193 L D -1.0339
1194 N D -2.1010
1195 G D -2.2093
1196 K D -2.3417
1197 E D -2.5128
1198 Y D 0.0000
1199 K D -1.9382
1200 C D 0.0000
1201 K D -1.7592
1202 V D 0.0000
1203 S D -1.4426
1204 N D -1.8214
1205 K D -2.1042
1206 A D -1.2988
1207 L D -0.6217
1208 P D -0.5007
1209 A D -0.3603
1210 P D -0.5371
1211 I D -0.5904
1212 E D -1.6312
1213 K D -1.6534
1214 T D -1.3962
1215 I D -0.3081
1216 S D -1.6829
1217 K D -1.4556
1218 A D -1.2918
1219 K D -2.3417
1220 G D -2.1156
1221 Q D -2.2046
1222 P D -2.3222
1223 R D -2.9873
1224 E D -2.8647
1225 P D 0.0000
1226 Q D -1.3173
1227 V D 0.0000
1228 Y D 0.0000
1229 T D 0.0000
1230 L D -0.1180
1231 P D -0.4246
1232 P D -0.7501
1233 S D -1.3965
1234 R D -2.6004
1235 D D -2.7445
1236 E D 0.0000
1237 L D -1.2454
1238 T D -1.3421
1239 K D -2.2293
1240 N D -2.5520
1241 Q D -2.6430
1242 V D 0.0000
1243 S D 0.0000
1244 L D 0.0000
1245 T D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 V D 0.0000
1249 K D 0.0000
1250 G D -1.1572
1251 F D 0.0000
1252 Y D -1.4607
1253 P D 0.0000
1254 S D -0.0802
1255 D D -0.9742
1256 I D 0.0000
1257 A D -0.4770
1258 V D 0.0000
1259 E D -1.1199
1260 W D 0.0000
1261 E D -2.1159
1262 S D 0.0000
1263 N D -2.4090
1264 G D -1.9373
1265 Q D -2.3221
1266 P D -2.1675
1267 E D -2.5062
1268 N D -2.1527
1269 N D -1.5632
1270 Y D -0.9131
1271 K D -0.4073
1272 T D -0.2671
1273 T D 0.0000
1274 P D 0.0229
1275 P D 0.2573
1276 V D 0.8470
1277 L D 1.0735
1278 D D -0.2447
1279 S D -1.1837
1280 D D -1.9724
1281 G D -0.9446
1282 S D -0.8481
1283 F D 0.0000
1284 F D 0.0000
1285 L D 0.0000
1286 Y D 0.0000
1287 S D 0.0000
1288 K D 0.0000
1289 L D 0.0000
1290 T D -0.9218
1291 V D 0.0000
1292 D D -2.7032
1293 K D -2.4083
1294 S D -2.4547
1295 R D -3.4801
1296 W D -2.6663
1297 Q D -2.9566
1298 Q D -3.0975
1299 G D -2.4861
1300 N D -2.3104
1301 V D -1.2392
1302 F D 0.0000
1303 S D -1.1813
1304 C D 0.0000
1305 S D -0.8350
1306 V D 0.0000
1307 M D -0.4845
1308 H D 0.0000
1309 E D -1.1478
1310 A D -1.8654
1311 L D 0.0000
1312 H D -1.7276
1313 N D -1.6183
1314 H D -1.0021
1315 Y D -0.3636
1316 T D -1.0186
1317 Q D -1.4230
1318 K D -1.3161
1319 S D -0.7152
1320 L D 0.0000
1321 S D -1.0587
1322 L D 0.0000
1323 S D -1.7719
1324 P D -2.0532
1325 G D -1.9905
1326 K D -2.5137

 

Laboratory of Theory of Biopolymers 2015