Project name: a87515349982c24 [mutate: VA23D]

Chain sequence(s)	A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA23D
Energy difference between WT (input) and mutated protein (by FoldX)	3.79237 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.3511
• Maximal score value: 0.9319
• Average score: -1.2531
• Total score value: -71.4288

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
6	K	A	-2.1778
7	E	A	-2.0630
8	L	A	-0.4267
9	V	A	0.0000
10	L	A	0.1535
11	A	A	0.0000
12	L	A	-0.2809
13	Y	A	-0.7397
14	D	A	-2.5853
15	Y	A	0.0000
16	Q	A	-2.3626
17	E	A	-2.2642
18	K	A	-2.5209
19	S	A	-1.6602
20	P	A	-1.3053
21	R	A	-1.8270
22	E	A	0.0000
23	D	A	0.0000	mutated: VA23D
24	T	A	-1.8104
25	M	A	0.0000
26	K	A	-3.0255
27	K	A	-2.5344
28	G	A	-1.3551
29	D	A	-0.9522
30	I	A	0.9319
31	L	A	0.0000
32	T	A	-0.7361
33	L	A	0.0000
34	L	A	-0.8179
35	N	A	-1.0956
36	S	A	-1.4315
37	T	A	-1.5881
38	N	A	-2.8404
39	K	A	-3.1620
40	D	A	-2.8135
41	W	A	-1.5150
42	W	A	-1.0399
43	K	A	-1.1120
44	V	A	0.0000
45	E	A	-1.8830
46	V	A	-2.0688
47	N	A	-2.5512
48	D	A	-3.3511
49	R	A	-3.1287
50	Q	A	-2.7152
51	G	A	0.0000
52	F	A	-0.7777
53	V	A	0.0000
54	P	A	-0.5859
55	A	A	-1.2600
56	A	A	-0.3168
57	Y	A	0.1279
58	V	A	0.0000
59	K	A	-1.3142
60	K	A	-1.6058
61	L	A	-0.8134
62	D	A	-2.2271