Project name: a87515349982c24 [mutate: VA23D]

Status: done

submitted: 2018-01-12 15:52:51, status changed: 2018-01-12 16:00:44
Settings
Chain sequence(s) A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues VA23D
Energy difference between WT (input) and mutated protein (by FoldX) 3.79237 kcal/mol
Show buried residues

Minimal score value
-3.3511
Maximal score value
0.9319
Average score
-1.2531
Total score value
-71.4288

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 K A -2.1778
7 E A -2.0630
8 L A -0.4267
9 V A 0.0000
10 L A 0.1535
11 A A 0.0000
12 L A -0.2809
13 Y A -0.7397
14 D A -2.5853
15 Y A 0.0000
16 Q A -2.3626
17 E A -2.2642
18 K A -2.5209
19 S A -1.6602
20 P A -1.3053
21 R A -1.8270
22 E A 0.0000
23 D A 0.0000 mutated: VA23D
24 T A -1.8104
25 M A 0.0000
26 K A -3.0255
27 K A -2.5344
28 G A -1.3551
29 D A -0.9522
30 I A 0.9319
31 L A 0.0000
32 T A -0.7361
33 L A 0.0000
34 L A -0.8179
35 N A -1.0956
36 S A -1.4315
37 T A -1.5881
38 N A -2.8404
39 K A -3.1620
40 D A -2.8135
41 W A -1.5150
42 W A -1.0399
43 K A -1.1120
44 V A 0.0000
45 E A -1.8830
46 V A -2.0688
47 N A -2.5512
48 D A -3.3511
49 R A -3.1287
50 Q A -2.7152
51 G A 0.0000
52 F A -0.7777
53 V A 0.0000
54 P A -0.5859
55 A A -1.2600
56 A A -0.3168
57 Y A 0.1279
58 V A 0.0000
59 K A -1.3142
60 K A -1.6058
61 L A -0.8134
62 D A -2.2271

 

Laboratory of Theory of Biopolymers 2015