Project name: P166

Status: done

submitted: 2017-09-13 10:25:35, status changed: 2017-09-13 14:19:14
Settings
Chain sequence(s) A: VIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNPMYVSDTVTFVNVATCAQGVSRSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQILIENAAGHRVCISTYTTNLGSGPVSISAVGVLAPHSA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.5008
Maximal score value
2.4611
Average score
-0.7825
Total score value
-131.4572

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 2.4611
2 I A 2.1083
3 Q A -0.4753
4 D A -2.0024
5 Y A -0.6327
6 D A -2.4363
7 N A -3.4936
8 Q A -3.8025
9 H A -4.3388
10 E A -4.1572
11 Q A -4.1140
12 D A -4.5008
13 R A -4.2457
14 P A -2.4523
15 T A -1.2489
16 P A -0.8302
17 S A -0.5816
18 P A -0.5207
19 A A -0.5010
20 P A -0.6887
21 S A -0.8478
22 R A -0.6890
23 P A -0.5742
24 F A 0.0000
25 S A -0.8411
26 V A -0.5672
27 L A 0.0000
28 R A -2.4675
29 A A -1.8477
30 N A -1.8291
31 D A 0.0000
32 V A 0.9591
33 L A 0.0000
34 W A 1.2640
35 L A 0.0000
36 S A 0.1674
37 L A 0.0000
38 T A -0.7394
39 A A -0.9260
40 A A 0.0000
41 E A -2.9601
42 Y A 0.0000
43 D A -2.6177
44 Q A -1.2205
45 T A -0.7365
46 T A -0.0793
47 Y A -0.0251
48 G A -0.3667
49 S A -0.3958
50 S A -0.4946
51 T A -0.2768
52 N A -0.2602
53 P A 0.0000
54 M A 0.0000
55 Y A 0.0000
56 V A -1.1683
57 S A 0.0000
58 D A -2.6707
59 T A -1.2962
60 V A 0.0000
61 T A 0.0723
62 F A 0.0000
63 V A 0.9259
64 N A 0.0000
65 V A 2.2795
66 A A 1.2499
67 T A 0.5832
68 C A 0.9673
69 A A 0.0042
70 Q A -0.4623
71 G A -0.1329
72 V A 0.3396
73 S A 0.0000
74 R A -2.3026
75 S A -1.0384
76 L A -1.3421
77 D A -2.5449
78 W A 0.0000
79 S A -1.7837
80 K A -2.3532
81 V A 0.0000
82 T A -1.4377
83 L A 0.0000
84 D A -2.2085
85 G A -1.6945
86 R A -2.0923
87 P A -1.4781
88 L A 0.0000
89 T A -0.0469
90 T A 0.0056
91 I A 0.0856
92 Q A -1.4195
93 Q A -1.1440
94 Y A -0.4368
95 S A -1.1612
96 K A -2.1963
97 T A -1.4634
98 F A 0.0000
99 Y A -0.3170
100 V A 0.0000
101 L A 0.0000
102 P A -0.6429
103 L A 0.0000
104 R A -2.4855
105 G A -1.8373
106 K A -2.0869
107 L A -1.0211
108 S A -0.3917
109 F A 0.0000
110 W A -0.8675
111 E A -1.3477
112 A A -0.7547
113 G A -0.9645
114 T A -0.8083
115 T A -1.3464
116 K A -1.9531
117 A A -1.0288
118 G A -0.3001
119 Y A 1.0901
120 P A 0.1813
121 Y A -0.4355
122 N A -0.6225
123 Y A 0.4597
124 N A -0.9982
125 T A -0.8305
126 T A -0.4734
127 A A -1.3539
128 S A -1.2214
129 D A 0.0000
130 Q A -0.9451
131 I A 0.0000
132 L A 0.0000
133 I A 0.0000
134 E A 0.0000
135 N A -1.9461
136 A A -1.2893
137 A A -0.7927
138 G A -1.6874
139 H A -2.0011
140 R A -2.1016
141 V A 0.0000
142 C A 0.0000
143 I A 0.0000
144 S A 0.0000
145 T A 0.0000
146 Y A 0.0000
147 T A -0.4462
148 T A -1.0903
149 N A -1.7106
150 L A -1.6369
151 G A -1.7357
152 S A -1.4232
153 G A -1.6854
154 P A -1.2870
155 V A 0.0000
156 S A -0.6965
157 I A 0.0000
158 S A -0.2413
159 A A 0.0000
160 V A 0.9289
161 G A 0.0000
162 V A -0.6028
163 L A 0.0000
164 A A -1.5662
165 P A -1.3491
166 H A -1.0051
167 S A -0.3394
168 A A -0.2628

 

Laboratory of Theory of Biopolymers 2015