Project name: 7ee8d5ae7f21426

Status: done

submitted: 2017-12-06 11:46:53, status changed: 2017-12-06 13:05:44
Settings
Chain sequence(s) A: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIRYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCILVSGGIGWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: QSVLTQPPSVSGAPGQRVTISCSGSRSNIGSNTVKWYQQLPGTAPKLLIYYNDQRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRYTHPALLFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIRYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCILVSGGIGWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QSVLTQPPSVSGAPGQRVTISCSGSRSNIGSNTVKWYQQLPGTAPKLLIYYNDQRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRYTHPALLFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0722
Maximal score value
1.6341
Average score
-0.8088
Total score value
-1070.8325

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.2725
2 V A -0.4600
3 Q A -0.7656
4 L A 0.0000
5 V A 1.1386
6 E A 0.0000
7 S A -0.3256
8 G A -0.5510
9 G A -0.1457
10 G A 0.2791
11 V A 0.9863
12 V A 0.0000
13 Q A -2.0692
14 P A -2.5744
15 G A -2.4921
16 R A -2.9115
17 S A -2.6034
18 L A -1.4086
19 R A -1.9963
20 L A 0.0000
21 S A -0.2200
22 C A 0.0000
23 A A -0.0469
24 A A 0.0000
25 S A -0.5219
26 G A -0.8368
27 F A -0.3200
28 T A -0.2023
29 F A 0.0000
30 S A -1.6606
31 S A -0.7775
32 Y A -0.5397
33 G A 0.0000
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.8023
39 Q A -1.1563
40 A A 0.0000
41 P A -1.3563
42 G A -1.5493
43 K A -2.4267
44 G A -1.6385
45 L A 0.0000
46 E A -1.2760
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 F A 0.0000
51 I A 0.0000
52 R A -2.7983
53 Y A 0.0000
54 D A -3.1095
55 G A -2.4705
56 S A -2.5313
57 N A -2.3960
58 K A -1.1637
59 Y A -0.3458
60 Y A -0.8401
61 A A -1.6053
62 D A -2.6658
63 S A -2.0011
64 V A 0.0000
65 K A -2.8700
66 G A -2.5982
67 R A -3.1140
68 F A -1.8869
69 T A -1.2045
70 I A 0.0000
71 S A -0.8387
72 R A -1.8073
73 D A -2.0870
74 N A -2.6909
75 S A -1.9468
76 K A -2.5451
77 N A -1.8999
78 T A -1.0138
79 L A 0.0000
80 Y A -0.4426
81 L A 0.0000
82 Q A -1.4807
83 M A 0.0000
84 N A -2.8985
85 S A -2.3874
86 L A 0.0000
87 R A -3.3795
88 A A -2.1770
89 E A -2.5823
90 D A -1.9764
91 T A -0.8275
92 A A 0.0000
93 V A 0.1101
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 I A 0.0000
98 L A 0.0000
99 V A 0.0795
100 S A -0.0556
101 G A -0.4410
102 G A 0.0252
103 I A 0.2922
104 G A -0.1135
105 W A 0.0000
106 G A 0.0000
107 Q A -0.8533
108 G A 0.0000
109 T A 0.0000
110 M A 0.5425
111 V A 0.0000
112 T A -0.1411
113 V A 0.0000
114 S A -1.1954
115 S A -0.8083
116 A A -0.6107
117 S A -0.5380
118 T A -0.8610
119 K A -1.3966
120 G A -1.3335
121 P A -0.5822
122 S A 0.0167
123 V A -0.3011
124 F A -0.1433
125 P A -0.7483
126 L A 0.0000
127 A A 0.0000
128 P A 0.0000
129 S A -1.2020
130 S A -1.2415
131 K A -2.0000
132 S A -1.3677
133 T A -1.1003
134 S A -0.9080
135 G A -0.8625
136 G A -0.9165
137 T A -0.7940
138 A A -0.5884
139 A A 0.0000
140 L A 0.0000
141 G A 0.0000
142 C A 0.0000
143 L A 0.0000
144 V A 0.0000
145 K A 0.0000
146 D A 0.0000
147 Y A 0.0000
148 F A 0.0000
149 P A -0.8430
150 E A -1.4883
151 P A -1.2449
152 V A -0.9081
153 T A -0.6673
154 V A -0.2310
155 S A -0.4583
156 W A 0.0000
157 N A -0.7488
158 S A -0.7073
159 G A -0.6016
160 A A -0.2827
161 L A -0.0690
162 T A -0.2319
163 S A -0.2306
164 G A -0.2816
165 V A 0.0854
166 H A 0.0000
167 T A 0.0152
168 F A 0.0000
169 P A -0.2231
170 A A -0.0669
171 V A 0.5008
172 L A 0.9232
173 Q A 0.2353
174 S A -0.1681
175 S A -0.2110
176 G A -0.0088
177 L A 0.0139
178 Y A 0.3187
179 S A 0.0000
180 L A 0.0000
181 S A 0.0000
182 S A 0.0000
183 V A 0.0000
184 V A 0.0000
185 T A -0.1849
186 V A 0.0000
187 P A -0.5338
188 S A -0.6428
189 S A -0.5450
190 S A -0.6842
191 L A -0.8302
192 G A -1.0442
193 T A -0.8771
194 Q A -1.5181
195 T A -1.1988
196 Y A 0.0000
197 I A -1.2696
198 C A 0.0000
199 N A -1.5307
200 V A 0.0000
201 N A -1.9236
202 H A 0.0000
203 K A -2.8813
204 P A -1.8667
205 S A -2.0295
206 N A -2.6112
207 T A -2.1005
208 K A -2.6355
209 V A -1.5507
210 D A -2.4677
211 K A -1.9210
212 K A -2.2019
213 V A 0.0000
214 E A -2.6992
215 P A -1.6662
216 K A -1.9126
217 S A -1.6000
218 C A -0.8964
219 D A -2.3101
220 K A -2.9662
221 T A -2.3662
222 H A -2.2688
223 T A 0.0000
224 C A -0.5118
225 P A -0.5492
226 P A -0.1227
227 C A 0.4018
228 P A -0.3249
229 A A -1.0207
230 P A -1.2255
231 E A -1.4227
232 L A 1.1160
233 L A 1.2685
234 G A 0.3491
235 G A -0.2077
236 P A 0.0000
237 S A -0.0696
238 V A 0.0000
239 F A 1.0284
240 L A 0.7988
241 F A 1.0034
242 P A -0.1721
243 P A 0.0000
244 K A -2.3484
245 P A -1.4704
246 K A -1.6040
247 D A 0.0000
248 T A 0.0000
249 L A 0.0000
250 M A 0.1490
251 I A 1.2100
252 S A -0.2034
253 R A -1.7528
254 T A -0.9255
255 P A 0.0000
256 E A -1.2016
257 V A 0.0000
258 T A 0.4017
259 C A 0.0000
260 V A 0.0000
261 V A 0.0000
262 V A -0.8824
263 D A -1.4357
264 V A 0.0000
265 S A -2.0109
266 H A -2.5413
267 E A -2.9368
268 D A 0.0000
269 P A -2.4542
270 E A -2.8689
271 V A -1.8279
272 K A -2.1702
273 F A -1.2466
274 N A -1.1092
275 W A 0.0000
276 Y A -0.5669
277 V A -0.5906
278 D A -1.5766
279 G A -0.5050
280 V A 1.0004
281 E A -0.3552
282 V A -0.3042
283 H A -1.7708
284 N A -2.0797
285 A A -1.6281
286 K A -2.4929
287 T A -2.1423
288 K A -2.7412
289 P A -2.4160
290 R A -3.5960
291 E A -4.0722
292 E A -3.5323
293 Q A -2.0732
294 Y A 0.0145
295 N A -1.2481
296 S A -1.3230
297 T A -1.9565
298 Y A 0.0000
299 R A -3.0972
300 V A 0.0000
301 V A 0.0000
302 S A 0.0000
303 V A -0.8659
304 L A 0.0000
305 T A -0.6706
306 V A 0.0000
307 L A -0.0087
308 H A -0.6495
309 Q A -1.6374
310 D A -1.7696
311 W A 0.0000
312 L A -1.1532
313 N A -2.2161
314 G A -2.0845
315 K A -2.2926
316 E A -2.3732
317 Y A 0.0000
318 K A -1.6011
319 C A 0.0000
320 K A -1.6317
321 V A 0.0000
322 S A -1.4212
323 N A 0.0000
324 K A -2.3197
325 A A -1.4531
326 L A 0.0000
327 P A -0.3757
328 A A -0.4464
329 P A -0.7822
330 I A -0.6970
331 E A -2.0204
332 K A -1.3061
333 T A -1.0661
334 I A -0.3186
335 S A -1.1220
336 K A 0.0000
337 A A -0.8932
338 K A -2.1649
339 G A -1.8737
340 Q A -2.0974
341 P A -2.2874
342 R A -3.0671
343 E A -2.9851
344 P A 0.0000
345 Q A -1.1713
346 V A 0.0000
347 Y A 0.0000
348 T A 0.0000
349 L A 0.0000
350 P A -0.4031
351 P A 0.0000
352 S A -1.5086
353 R A -2.6964
354 E A -2.8482
355 E A 0.0000
356 M A -1.9739
357 T A -1.7675
358 K A -2.4364
359 N A -2.6166
360 Q A -2.3753
361 V A 0.0000
362 S A 0.0000
363 L A 0.0000
364 T A 0.0000
365 C A 0.0000
366 L A 0.0000
367 V A 0.0000
368 K A -0.5661
369 G A -1.2918
370 F A 0.0000
371 Y A -1.3124
372 P A 0.0000
373 S A -0.1824
374 D A -0.8073
375 I A -0.5259
376 A A 0.0000
377 V A -0.4694
378 E A -1.2805
379 W A 0.0000
380 E A -1.6718
381 S A -1.2593
382 N A -1.8777
383 G A -1.8744
384 Q A -2.3116
385 P A -1.9810
386 E A -1.8358
387 N A -2.0548
388 N A -1.4380
389 Y A -0.9876
390 K A -1.0865
391 T A -0.4520
392 T A 0.0000
393 P A -0.1466
394 P A 0.1613
395 V A 0.4725
396 L A 0.6309
397 D A -0.5177
398 S A -1.1230
399 D A -1.8895
400 G A -1.0331
401 S A 0.0000
402 F A 0.0199
403 F A 0.0000
404 L A 0.0000
405 Y A 0.0000
406 S A 0.0000
407 K A 0.0000
408 L A 0.0000
409 T A -0.9035
410 V A 0.0000
411 D A -2.5140
412 K A -2.7015
413 S A -2.2615
414 R A -2.0422
415 W A 0.0000
416 Q A -2.7743
417 Q A -2.5766
418 G A -1.7058
419 N A -1.0245
420 V A 0.5874
421 F A 0.0000
422 S A -0.6966
423 C A 0.0000
424 S A 0.0000
425 V A 0.0000
426 M A 0.0000
427 H A 0.0000
428 E A -1.1570
429 A A -1.8847
430 L A 0.0000
431 H A -1.9144
432 N A -1.8000
433 H A -1.3392
434 Y A -0.5728
435 T A -0.8004
436 Q A -1.2175
437 K A -0.9339
438 S A -0.3257
439 L A 0.0000
440 S A -0.0626
441 L A -0.6345
442 S A -0.7500
443 P A -0.9742
444 G A -1.7040
445 K A -2.5858
446 Q B -1.1371
447 V B -0.2413
448 Q B -0.8848
449 L B 0.0000
450 V B 0.3161
451 E B -0.4017
452 S B -0.7925
453 G B -0.7531
454 G B -0.4154
455 G B 0.1453
456 V B 1.1820
457 V B -0.1611
458 Q B -1.2153
459 P B -1.9829
460 G B -2.2947
461 R B -2.6520
462 S B -2.0864
463 L B -1.2686
464 R B -1.9943
465 L B 0.0000
466 S B -0.4768
467 C B 0.0000
468 A B -0.4872
469 A B 0.0000
470 S B -0.5007
471 G B -0.6734
472 F B -0.1535
473 T B -0.1528
474 F B 0.0000
475 S B -1.4449
476 S B -0.6192
477 Y B -0.3487
478 G B 0.0000
479 M B 0.0000
480 H B 0.0000
481 W B 0.0000
482 V B 0.0000
483 R B -0.7733
484 Q B -1.1202
485 A B -1.4470
486 P B -1.3007
487 G B -1.5045
488 K B -2.3492
489 G B -1.4361
490 L B -0.9586
491 E B -1.3461
492 W B 0.0000
493 V B 0.0000
494 A B 0.0000
495 F B -0.2995
496 I B 0.0000
497 R B -2.4509
498 Y B -2.3523
499 D B -2.7024
500 G B -2.2754
501 S B -2.2705
502 N B -2.3048
503 K B -1.4637
504 Y B -0.9294
505 Y B -1.0006
506 A B -1.5806
507 D B -2.5805
508 S B -1.8416
509 V B 0.0000
510 K B -2.6444
511 G B -1.9599
512 R B -1.6227
513 F B 0.0000
514 T B -0.9788
515 I B 0.0000
516 S B -0.9146
517 R B -1.9019
518 D B -2.3439
519 N B -2.9223
520 S B -2.0960
521 K B -2.7275
522 N B -2.2520
523 T B 0.0000
524 L B 0.0000
525 Y B -0.5777
526 L B 0.0000
527 Q B -1.2742
528 M B 0.0000
529 N B -2.1942
530 S B -2.0277
531 L B 0.0000
532 R B -3.0544
533 A B -1.7927
534 E B -2.3956
535 D B 0.0000
536 T B -0.5829
537 A B 0.0000
538 V B -0.0007
539 Y B 0.0000
540 Y B 0.0000
541 C B 0.0000
542 I B 0.0000
543 L B 0.0000
544 V B 0.0000
545 S B 0.1083
546 G B 0.1370
547 G B 0.3061
548 I B 1.5820
549 G B 0.7071
550 W B 0.9988
551 G B 0.1365
552 Q B -1.0028
553 G B -0.8932
554 T B -0.6165
555 M B -0.2009
556 V B 0.1705
557 T B -0.1314
558 V B 0.0000
559 S B 0.0000
560 S B -0.3241
561 A B -0.4356
562 S B -0.7353
563 T B 0.0000
564 K B -1.7216
565 G B -0.9504
566 P B 0.0000
567 S B -0.1424
568 V B 0.0000
569 F B 0.3574
570 P B 0.0000
571 L B -0.4336
572 A B -0.3700
573 P B -0.4349
574 S B -0.5826
575 S B -1.4776
576 K B -2.1745
577 S B -1.7424
578 T B -0.8276
579 S B -1.0752
580 G B -1.4729
581 G B -1.0847
582 T B -0.6259
583 A B -0.1932
584 A B 0.0000
585 L B 0.0000
586 G B 0.0000
587 C B 0.0000
588 L B -0.1164
589 V B 0.0000
590 K B -0.6040
591 D B -0.8960
592 Y B 0.0000
593 F B 0.0000
594 P B 0.0000
595 E B -0.3428
596 P B -0.6499
597 V B -0.6019
598 T B -0.5103
599 V B -0.1666
600 S B -0.3647
601 W B 0.0000
602 N B -0.7821
603 S B -0.6908
604 G B -0.5981
605 A B -0.2863
606 L B -0.0209
607 T B -0.2025
608 S B -0.2209
609 G B -0.2975
610 V B 0.1059
611 H B -0.2992
612 T B -0.0799
613 F B 0.0000
614 P B -0.3215
615 A B 0.0641
616 V B 0.5446
617 L B 1.1489
618 Q B 0.2809
619 S B -0.0713
620 S B -0.2217
621 G B 0.0000
622 L B 0.0000
623 Y B 0.1256
624 S B 0.0000
625 L B 0.0000
626 S B -0.0415
627 S B 0.0000
628 V B 0.0000
629 V B 0.0000
630 T B -0.2416
631 V B 0.0000
632 P B -0.4432
633 S B -0.5901
634 S B -0.6613
635 S B -0.6299
636 L B -1.0945
637 G B -1.5913
638 T B -0.7348
639 Q B -1.2086
640 T B -1.1757
641 Y B 0.0000
642 I B -1.5334
643 C B 0.0000
644 N B -1.4655
645 V B 0.0000
646 N B -1.8426
647 H B 0.0000
648 K B -2.7450
649 P B -2.0129
650 S B -2.2211
651 N B -2.7038
652 T B -2.4052
653 K B -2.8968
654 V B -2.0705
655 D B -2.8856
656 K B -2.9519
657 K B -3.1786
658 V B 0.0000
659 E B -3.1716
660 P B -2.5785
661 K B -2.6595
662 S B -1.7345
663 C B -0.9522
664 D B -2.3952
665 K B -2.8895
666 T B -1.9542
667 H B -1.4661
668 T B -0.6468
669 C B 0.2091
670 P B -0.0617
671 P B -0.0749
672 C B 0.3113
673 P B -0.4701
674 A B -0.5613
675 P B -0.7842
676 E B -0.7310
677 L B 1.5866
678 L B 1.6341
679 G B 0.3481
680 G B -0.3582
681 P B 0.0000
682 S B -0.0519
683 V B 0.0000
684 F B 1.2104
685 L B 0.9773
686 F B 1.4006
687 P B 0.0306
688 P B 0.0000
689 K B -2.1336
690 P B -1.3514
691 K B -1.1434
692 D B 0.0000
693 T B 0.0000
694 L B -0.2865
695 M B 0.6277
696 I B 1.5425
697 S B 0.0978
698 R B -1.2445
699 T B -0.6316
700 P B 0.0000
701 E B -0.7378
702 V B 0.0000
703 T B 0.3945
704 C B 0.0000
705 V B 0.0000
706 V B 0.0000
707 V B -0.8804
708 D B -2.2465
709 V B 0.0000
710 S B -1.4057
711 H B -1.5774
712 E B -1.4120
713 D B 0.0000
714 P B -2.0236
715 E B -2.5836
716 V B -1.8614
717 K B -2.1362
718 F B -1.4176
719 N B -1.4372
720 W B 0.0000
721 Y B -1.0564
722 V B -1.1018
723 D B -2.2305
724 G B -1.0253
725 V B 0.1949
726 E B -1.5196
727 V B -0.9813
728 H B -1.9224
729 N B -2.2847
730 A B -1.7635
731 K B -2.4701
732 T B -1.9966
733 K B -2.5425
734 P B -2.4730
735 R B -3.5455
736 E B -3.8059
737 E B -3.6659
738 Q B -2.3504
739 Y B -0.3204
740 N B -1.4083
741 S B -1.3431
742 T B -2.1624
743 Y B -2.7742
744 R B -2.6727
745 V B 0.0000
746 V B -0.9654
747 S B 0.0000
748 V B 0.0000
749 L B 0.0000
750 T B -0.5553
751 V B 0.0000
752 L B 0.3054
753 H B -0.2782
754 Q B -1.4479
755 D B -1.3543
756 W B 0.0000
757 L B -0.9467
758 N B -2.1074
759 G B -2.0710
760 K B -2.2161
761 E B -2.2534
762 Y B 0.0000
763 K B -1.7690
764 C B 0.0000
765 K B -1.6424
766 V B 0.0000
767 S B -1.3715
768 N B 0.0000
769 K B -1.8840
770 A B -1.0329
771 L B -0.0140
772 P B -0.2594
773 A B -0.5888
774 P B -0.8445
775 I B -0.7657
776 E B -2.1211
777 K B -1.1998
778 T B -0.9465
779 I B -0.1771
780 S B -1.1378
781 K B -1.2206
782 A B -1.2003
783 K B -2.3844
784 G B -2.0708
785 Q B -2.3355
786 P B -2.1514
787 R B -2.5315
788 E B -2.9008
789 P B 0.0000
790 Q B -1.1061
791 V B -0.7441
792 Y B 0.0000
793 T B 0.0000
794 L B 0.0000
795 P B -0.3775
796 P B 0.0000
797 S B -1.5565
798 R B -2.8107
799 E B -2.8594
800 E B 0.0000
801 M B -2.0401
802 T B -1.7462
803 K B -2.4879
804 N B -2.6136
805 Q B -2.4683
806 V B 0.0000
807 S B 0.0000
808 L B 0.0000
809 T B 0.0000
810 C B 0.0000
811 L B 0.0000
812 V B 0.0000
813 K B -0.5984
814 G B -1.1487
815 F B 0.0000
816 Y B -1.3293
817 P B 0.0000
818 S B -0.3279
819 D B -1.0483
820 I B 0.0000
821 A B -0.4305
822 V B -0.1721
823 E B -0.7719
824 W B 0.0000
825 E B -1.5842
826 S B 0.0000
827 N B -1.8477
828 G B -1.8653
829 Q B -2.2840
830 P B -1.8554
831 E B -1.7457
832 N B -1.9042
833 N B -1.2261
834 Y B -0.7262
835 K B -0.6627
836 T B -0.2112
837 T B 0.0000
838 P B -0.2303
839 P B -0.0816
840 V B 0.0000
841 L B 0.2590
842 D B -0.8227
843 S B -1.2554
844 D B -1.9453
845 G B -0.9953
846 S B 0.0000
847 F B -0.1450
848 F B 0.0000
849 L B 0.0000
850 Y B 0.0000
851 S B 0.0000
852 K B 0.0000
853 L B 0.0000
854 T B -0.8548
855 V B 0.0000
856 D B -2.5230
857 K B -2.7990
858 S B -2.3809
859 R B -2.1677
860 W B 0.0000
861 Q B -2.4082
862 Q B -2.1646
863 G B -1.1295
864 N B -0.6793
865 V B 0.4932
866 F B 0.0000
867 S B -0.6531
868 C B 0.0000
869 S B 0.0000
870 V B 0.0000
871 M B -0.5037
872 H B 0.0000
873 E B -1.2658
874 A B -1.8693
875 L B 0.0000
876 H B -2.0561
877 N B -1.9512
878 H B -1.6391
879 Y B -0.6037
880 T B -0.7833
881 Q B -1.0503
882 K B -0.8981
883 S B -0.3309
884 L B 0.0000
885 S B -0.0292
886 L B -0.2403
887 S B -0.4073
888 P B -0.8771
889 G B -1.4263
890 K B -1.9863
891 Q C -1.2732
892 S C -0.6006
893 V C 0.2486
894 L C 0.0000
895 T C -0.1012
896 Q C -0.3312
897 P C -0.5426
898 P C -0.5780
899 S C -0.6532
900 V C -0.3556
901 S C -0.4300
902 G C 0.0000
903 A C -0.8989
904 P C -1.5666
905 G C -1.7888
906 Q C -2.4368
907 R C -2.6775
908 V C 0.0000
909 T C -0.6469
910 I C 0.0000
911 S C -0.3629
912 C C 0.0000
913 S C -0.4504
914 G C 0.0000
915 S C -1.0423
916 R C -2.0084
917 S C -1.7423
918 N C -2.0963
919 I C 0.0000
920 G C -1.3061
921 S C -0.6152
922 N C -0.7672
923 T C 0.0000
924 V C 0.0000
925 K C -0.1424
926 W C 0.0000
927 Y C 0.0000
928 Q C 0.0000
929 Q C -0.8518
930 L C -0.6231
931 P C -0.4796
932 G C -0.7669
933 T C -0.7822
934 A C -0.9518
935 P C 0.0000
936 K C -1.2879
937 L C 0.0000
938 L C 0.0000
939 I C 0.0000
940 Y C -0.0739
941 Y C 0.4582
942 N C -0.6675
943 D C -1.6765
944 Q C -1.7887
945 R C -2.3453
946 P C 0.0000
947 S C -0.7614
948 G C -1.0389
949 V C -1.0275
950 P C -1.3183
951 D C -2.2342
952 R C -1.6524
953 F C 0.0000
954 S C -1.3535
955 G C 0.0000
956 S C -0.7904
957 K C -0.8219
958 S C -1.0757
959 G C -1.3729
960 T C -1.1414
961 S C -0.8116
962 A C 0.0000
963 S C -0.5057
964 L C 0.0000
965 A C -0.5507
966 I C 0.0000
967 T C -1.5403
968 G C -1.7016
969 L C 0.0000
970 Q C -2.1267
971 A C -1.4645
972 E C -2.2296
973 D C 0.0000
974 E C -1.4866
975 A C 0.0000
976 D C -1.0667
977 Y C 0.0000
978 Y C 0.0000
979 C C 0.0000
980 Q C 0.0000
981 S C 0.3061
982 Y C 0.1579
983 D C -0.5983
984 R C -0.6147
985 Y C 0.4430
986 T C -0.2929
987 H C -1.2174
988 P C -0.6548
989 A C -0.4187
990 L C -0.1751
991 L C 0.3453
992 F C 0.0000
993 G C 0.0000
994 T C -0.6263
995 G C -0.7157
996 T C 0.0000
997 K C -1.3321
998 V C 0.0000
999 T C 0.0000
1000 V C -0.7992
1001 L C -0.3518
1002 G C -0.4432
1003 Q C -1.1647
1004 P C -1.3470
1005 K C -2.3242
1006 A C -1.3784
1007 A C -0.8799
1008 P C -0.7289
1009 S C -0.5066
1010 V C 0.0000
1011 T C -0.2540
1012 L C 0.0000
1013 F C 0.0000
1014 P C -0.1405
1015 P C -0.3174
1016 S C 0.0000
1017 S C -0.8189
1018 E C -1.3484
1019 E C 0.0000
1020 L C -1.6858
1021 Q C -1.9805
1022 A C -1.6142
1023 N C -2.6640
1024 K C -2.3827
1025 A C 0.0000
1026 T C 0.0000
1027 L C 0.0000
1028 V C 0.0000
1029 C C 0.0000
1030 L C 0.0000
1031 I C 0.0000
1032 S C -0.3311
1033 D C -0.8018
1034 F C 0.0000
1035 Y C -1.2133
1036 P C -1.0597
1037 G C -0.4846
1038 A C -0.2081
1039 V C 0.0587
1040 T C -0.1080
1041 V C -0.1758
1042 A C -0.4015
1043 W C 0.0000
1044 K C -1.1944
1045 A C -1.5806
1046 D C -2.2878
1047 S C -1.3958
1048 S C -1.0081
1049 P C -0.8293
1050 V C -0.6082
1051 K C -1.4419
1052 A C -0.7975
1053 G C -0.6693
1054 V C -0.4552
1055 E C -1.4727
1056 T C -0.7525
1057 T C -0.5819
1058 T C -0.3754
1059 P C -0.6848
1060 S C -0.9276
1061 K C -1.5634
1062 Q C -1.8043
1063 S C -1.4806
1064 N C -1.8343
1065 N C 0.0000
1066 K C -1.4463
1067 Y C 0.0000
1068 A C 0.0000
1069 A C 0.0000
1070 S C 0.0000
1071 S C 0.0000
1072 Y C -0.2290
1073 L C 0.0000
1074 S C -0.4228
1075 L C -1.1967
1076 T C -1.9819
1077 P C 0.0000
1078 E C -3.3166
1079 Q C -2.7521
1080 W C 0.0000
1081 K C -3.2116
1082 S C -2.6620
1083 H C -2.9166
1084 R C -3.0106
1085 S C -1.9650
1086 Y C 0.0000
1087 S C 0.0000
1088 C C 0.0000
1089 Q C -0.7269
1090 V C 0.0000
1091 T C -0.7232
1092 H C 0.0000
1093 E C -2.0895
1094 G C -1.3633
1095 S C -0.8319
1096 T C -0.0473
1097 V C 0.5103
1098 E C -1.2460
1099 K C -1.3886
1100 T C -0.7618
1101 V C -0.4958
1102 A C -0.3588
1103 P C -0.6348
1104 T C -1.1645
1105 E C -1.5000
1106 C C -0.1896
1107 S C -0.2926
1108 Q D -1.0997
1109 S D -0.4081
1110 V D 0.9906
1111 L D 0.0000
1112 T D 0.1844
1113 Q D 0.0000
1114 P D -0.5066
1115 P D -0.6017
1116 S D -0.6782
1117 V D -0.3443
1118 S D -0.4632
1119 G D 0.0000
1120 A D -1.2168
1121 P D -1.5980
1122 G D -1.8140
1123 Q D -2.5180
1124 R D -2.7146
1125 V D 0.0000
1126 T D -0.5219
1127 I D 0.0000
1128 S D -0.3052
1129 C D 0.0000
1130 S D -0.3923
1131 G D -0.6495
1132 S D -1.0011
1133 R D -2.4124
1134 S D -2.0550
1135 N D -2.1246
1136 I D 0.0000
1137 G D -1.3634
1138 S D -0.9342
1139 N D -0.9690
1140 T D 0.0000
1141 V D 0.0000
1142 K D 0.0000
1143 W D 0.0000
1144 Y D 0.0000
1145 Q D 0.0000
1146 Q D -0.3011
1147 L D 0.3780
1148 P D 0.0420
1149 G D -0.5808
1150 T D -0.6541
1151 A D -1.0793
1152 P D -1.0641
1153 K D -1.5671
1154 L D 0.0000
1155 L D 0.0000
1156 I D 0.0000
1157 Y D -0.6056
1158 Y D -0.4760
1159 N D 0.0000
1160 D D -2.5029
1161 Q D -2.2075
1162 R D -2.4254
1163 P D -1.3493
1164 S D -0.8026
1165 G D -0.8705
1166 V D -1.0696
1167 P D -1.3042
1168 D D -2.2126
1169 R D -1.6316
1170 F D 0.0000
1171 S D -1.4281
1172 G D 0.0000
1173 S D -1.0570
1174 K D -0.8824
1175 S D -1.0391
1176 G D -1.2919
1177 T D -1.2777
1178 S D -0.7935
1179 A D 0.0000
1180 S D -0.5445
1181 L D 0.0000
1182 A D -0.5244
1183 I D 0.0000
1184 T D -1.5234
1185 G D -1.6218
1186 L D 0.0000
1187 Q D -1.8280
1188 A D -1.4596
1189 E D -2.1248
1190 D D 0.0000
1191 E D -1.1245
1192 A D 0.0000
1193 D D -0.4252
1194 Y D 0.0000
1195 Y D -0.0722
1196 C D 0.0000
1197 Q D 0.0000
1198 S D 0.0000
1199 Y D 0.0000
1200 D D -0.4793
1201 R D -0.5629
1202 Y D 0.4194
1203 T D -0.0845
1204 H D -0.8657
1205 P D 0.0000
1206 A D -0.4355
1207 L D -0.2767
1208 L D 0.3192
1209 F D 0.4211
1210 G D 0.0000
1211 T D -0.3490
1212 G D -0.4641
1213 T D 0.0000
1214 K D -1.2275
1215 V D 0.0000
1216 T D -0.5014
1217 V D 0.0000
1218 L D -0.4649
1219 G D -0.5170
1220 Q D 0.0000
1221 P D -1.3625
1222 K D -2.0750
1223 A D 0.0000
1224 A D -0.5024
1225 P D -0.6581
1226 S D -0.0642
1227 V D 0.0859
1228 T D 0.2624
1229 L D 0.0000
1230 F D 0.1072
1231 P D -0.1908
1232 P D -0.7022
1233 S D -1.3674
1234 S D -1.7287
1235 E D -2.5440
1236 E D 0.0000
1237 L D -2.3023
1238 Q D -2.3904
1239 A D -2.0042
1240 N D -2.8563
1241 K D -2.9954
1242 A D 0.0000
1243 T D 0.0000
1244 L D 0.0000
1245 V D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 I D 0.0000
1249 S D -0.2989
1250 D D -0.7280
1251 F D 0.0000
1252 Y D 0.0000
1253 P D -0.9115
1254 G D -0.3916
1255 A D -0.1542
1256 V D -0.0479
1257 T D -0.1657
1258 V D -0.1116
1259 A D -0.2776
1260 W D 0.0000
1261 K D -0.9458
1262 A D 0.0000
1263 D D -1.4069
1264 S D -0.9112
1265 S D -0.7148
1266 P D -0.6657
1267 V D -0.6010
1268 K D -1.4890
1269 A D -0.8050
1270 G D -0.6337
1271 V D -0.4223
1272 E D -1.4796
1273 T D -0.7754
1274 T D -0.5395
1275 T D -0.4159
1276 P D -0.7614
1277 S D -1.0682
1278 K D -1.8207
1279 Q D -2.1024
1280 S D -1.5051
1281 N D -1.4244
1282 N D 0.0000
1283 K D 0.0000
1284 Y D -0.4029
1285 A D 0.0000
1286 A D 0.0000
1287 S D 0.0000
1288 S D 0.0000
1289 Y D -0.2047
1290 L D 0.0000
1291 S D -0.4041
1292 L D -1.2032
1293 T D -2.3025
1294 P D -2.8343
1295 E D -3.3488
1296 Q D -2.7935
1297 W D 0.0000
1298 K D -3.1152
1299 S D -2.5402
1300 H D -2.4195
1301 R D -2.6331
1302 S D -1.4878
1303 Y D 0.0000
1304 S D -0.3906
1305 C D 0.0000
1306 Q D -0.6646
1307 V D 0.0000
1308 T D -0.9680
1309 H D 0.0000
1310 E D -2.3475
1311 G D -1.5520
1312 S D -1.0103
1313 T D -0.6227
1314 V D -0.6819
1315 E D -1.7590
1316 K D -1.1597
1317 T D -0.4272
1318 V D 0.5080
1319 A D 0.1077
1320 P D -0.1561
1321 T D -0.7088
1322 E D -1.1730
1323 C D -0.1478
1324 S D -0.0730

 

Laboratory of Theory of Biopolymers 2015