Project name: 2W9T_A_N48E

Status: done

submitted: 2017-05-19 19:27:39, status changed: 2017-05-19 19:36:08
Settings
Chain sequence(s) A: TLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDDQVDDMYITVIDGKFQGDTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRRKG
B: TLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDDQVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRRRKG
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.2812
Maximal score value
1.6005
Average score
-0.3931
Total score value
-125.0199

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -0.0977
2 L A 0.0000
3 S A 0.0000
4 I A 0.0000
5 I A 0.0000
6 V A 0.0000
7 A A 0.0098
8 H A 0.0000
9 D A 0.0000
10 K A -0.2050
11 Q A 0.0000
12 R A -0.2068
13 V A 0.0000
14 I A 0.0000
15 G A 0.0463
16 Y A 0.6630
17 Q A -0.2849
18 N A -0.2992
19 Q A -0.4353
20 L A 0.0000
21 P A 0.1854
22 W A 1.0034
23 H A -0.7772
24 L A 0.0000
25 P A -0.0770
26 N A -0.2748
27 D A 0.0000
28 L A -0.1668
29 K A -1.8308
30 H A -0.5521
31 I A 0.0000
32 K A -1.5153
33 Q A -1.3615
34 L A 0.0231
35 T A 0.0000
36 T A -0.1188
37 G A -0.5623
38 N A -0.4361
39 T A 0.0000
40 L A 0.0000
41 V A 0.0000
42 M A 0.0000
43 A A -0.1456
44 R A -1.1013
45 K A -1.8420
46 T A 0.0000
47 F A 0.0000
48 E A -1.8779
49 S A -0.4719
50 I A 0.1350
51 G A -0.7289
52 K A -1.7605
53 P A -0.3448
54 L A 0.1517
55 P A -0.4474
56 N A -1.3666
57 R A -0.7079
58 R A -0.9227
59 N A 0.0000
60 V A 0.0000
61 V A 0.0000
62 L A 0.2137
63 T A 0.0000
64 N A -1.4556
65 Q A -1.2207
66 A A -0.1610
67 S A -0.1501
68 F A 0.0602
69 H A -0.9946
70 H A -0.8198
71 E A -1.9545
72 G A -0.7474
73 V A -0.2265
74 D A -1.6371
75 V A 0.2515
76 I A 0.0000
77 N A -1.0269
78 S A -0.1951
79 L A 0.2069
80 D A -1.8246
81 E A -1.0784
82 I A 0.0000
83 K A -2.0236
84 E A -2.0805
85 L A -0.1467
86 S A -0.2527
87 G A -0.5486
88 H A -0.3365
89 V A 0.0000
90 F A 0.0000
91 I A 0.0000
92 F A 0.0000
93 G A 0.0000
94 G A 0.0000
95 Q A -0.3782
96 T A -0.1374
97 L A 0.0000
98 Y A 0.0000
99 E A -1.5287
100 A A -0.2615
101 M A 0.0000
102 I A 0.0000
103 D A -1.8710
104 Q A -0.7728
105 V A 0.0000
106 D A -0.5315
107 D A 0.0000
108 M A 0.0000
109 Y A 0.1693
110 I A 0.0000
111 T A 0.0000
112 V A 0.0000
113 I A 0.0000
114 D A -0.2268
115 G A -0.4357
116 K A -1.6495
117 F A -0.1776
118 Q A -1.1836
119 G A -0.8264
120 D A -1.8426
121 T A -0.1908
122 F A 0.7505
123 F A 0.0000
124 P A -0.0321
125 P A -0.0479
126 Y A 0.0000
127 T A 0.0000
128 F A 0.0000
129 E A -1.4585
130 N A -0.9461
131 W A 0.0000
132 E A -0.4481
133 V A 0.0000
134 E A -1.7504
135 S A -0.4139
136 S A 0.0000
137 V A 1.2062
138 E A -1.5373
139 G A 0.0000
140 Q A -1.0719
141 L A 0.3200
142 D A -1.0887
143 E A -2.2812
144 K A -2.0241
145 N A 0.0000
146 T A 0.0288
147 I A 0.5257
148 P A 0.0676
149 H A 0.0000
150 T A 0.0000
151 F A 0.0000
152 L A 0.0000
153 H A -0.1068
154 L A 0.0000
155 V A 0.3618
156 R A -0.5455
157 R A -2.1886
158 K A -2.1018
159 G A -0.7749
1 T B -0.0978
2 L B 0.0000
3 S B 0.0000
4 I B 0.0000
5 I B 0.0000
6 V B 0.0000
7 A B 0.0098
8 H B 0.0000
9 D B 0.0000
10 K B -1.8260
11 Q B -1.0873
12 R B -0.7037
13 V B 0.0000
14 I B 0.0000
15 G B -0.0507
16 Y B 0.0000
17 Q B -0.1734
18 N B 0.0000
19 Q B 0.0000
20 L B 0.0000
21 P B 0.0000
22 W B 0.0000
23 H B -0.1502
24 L B 0.0000
25 P B 0.0000
26 N B -0.2492
27 D B 0.0000
28 L B 0.0000
29 K B -1.0766
30 H B -0.3521
31 I B 0.0000
32 K B -0.8479
33 Q B -1.2665
34 L B 0.0370
35 T B 0.0000
36 T B -0.1118
37 G B -0.5573
38 N B -0.4483
39 T B 0.0000
40 L B 0.0000
41 V B 0.0000
42 M B 0.0000
43 A B -0.0557
44 R B -0.5482
45 K B -1.4085
46 T B 0.0000
47 F B 0.0000
48 E B -1.0195
49 S B 0.0000
50 I B 0.0000
51 G B -0.2904
52 K B -0.7101
53 P B -0.1823
54 L B 0.0000
55 P B -0.2732
56 N B -1.3175
57 R B -0.6283
58 R B -0.7931
59 N B 0.0000
60 V B 0.0000
61 V B 0.0000
62 L B 0.2093
63 T B 0.0000
64 N B -1.4944
65 Q B -1.4230
66 A B -0.1953
67 S B -0.1578
68 F B 0.0197
69 H B -1.0079
70 H B -0.8498
71 E B -1.9640
72 G B -0.7614
73 V B -0.2228
74 D B -1.6628
75 V B 0.1980
76 I B 0.0000
77 N B -1.0071
78 S B -0.1882
79 L B 0.2538
80 D B -1.8178
81 E B -1.0763
82 I B 0.0000
83 K B -2.0235
84 E B -2.0915
85 L B -0.2081
86 S B -0.2626
87 G B -0.5483
88 H B -0.3348
89 V B 0.0000
90 F B 0.0000
91 I B 0.0000
92 F B 0.0000
93 G B 0.0000
94 G B 0.0000
95 Q B -0.3490
96 T B -0.1321
97 L B 0.0000
98 Y B 0.0000
99 E B -1.7328
100 A B -0.2997
101 M B 0.0000
102 I B -0.0985
103 D B -1.8171
104 Q B -0.6947
105 V B 0.0000
106 D B -0.7228
107 D B 0.0000
108 M B 0.0000
109 Y B 0.1461
110 I B 0.0000
111 T B 0.0000
112 V B 0.3227
113 I B 0.0000
114 D B -1.7991
115 G B -0.6915
116 K B -1.6666
117 F B -0.3104
118 Q B -1.1945
119 G B -0.7864
120 D B -1.8333
121 T B -0.1694
122 F B 0.9100
123 F B 0.0000
124 P B 0.0000
125 P B -0.2053
126 Y B 0.2222
127 T B 0.3671
128 F B 1.6005
129 E B -1.7908
130 D B -2.1189
131 W B 0.0000
132 E B -1.4992
133 V B 1.1026
134 E B -1.5076
135 S B -0.4916
136 S B 0.1109
137 V B 1.4028
138 E B -1.5080
139 G B -0.6153
140 Q B -0.9845
141 L B 0.8834
142 D B -0.8744
143 E B -2.0466
144 K B -0.8283
145 N B 0.0000
146 T B 0.0522
147 I B 0.6363
148 P B 0.0249
149 H B 0.0000
150 T B -0.2048
151 F B 0.2919
152 L B 0.2080
153 H B -0.0663
154 L B 0.0000
155 V B 0.3755
156 R B -0.5298
157 R B -2.1902
158 K B -2.1040
159 G B -0.7661

 

Laboratory of Theory of Biopolymers 2015