Project name: 85eb8241559063e

Status: done

submitted: 2017-03-17 19:26:28, status changed: 2017-03-17 19:32:17
Settings
Chain sequence(s) A: LGGYMLGSAMSRPLIHFGNDYEDCYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKQHTVTTTTKGENFTETDIKIMERVVEQMCITQYQRESQAYYQRGA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.9252
Maximal score value
1.5321
Average score
-1.0525
Total score value
-111.5686

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
125 L A 1.2583
126 G A 0.1487
127 G A -0.1870
128 Y A 0.7454
129 M A 1.0521
130 L A 1.5321
131 G A 0.0000
132 S A -0.1211
133 A A -0.4703
134 M A -0.4857
135 S A -0.4500
136 R A -0.4872
137 P A 0.2525
138 L A 0.9014
139 I A -0.2571
140 H A -1.3131
141 F A 0.0000
142 G A -1.8248
143 N A -2.2501
144 D A -2.2044
145 Y A -0.4977
146 E A -1.7510
147 D A -1.9399
148 C A -1.0480
149 Y A -1.0110
150 Y A 0.0000
151 R A -2.4767
152 E A -2.8678
153 N A -1.9166
154 M A -1.5912
155 H A -2.0008
156 R A -1.4967
157 Y A 0.0000
158 P A 0.0000
159 N A -1.8217
160 Q A -0.8860
161 V A 0.0000
162 Y A 0.4552
163 Y A 0.0000
164 R A -0.9900
165 P A -1.1590
166 V A 0.0000
167 D A -2.3420
168 Q A -2.5385
169 Y A -2.2339
170 S A -1.7849
171 N A -2.4260
172 Q A -2.2674
173 N A -2.7020
174 N A -2.9252
175 F A 0.0000
176 V A 0.0000
177 H A -2.5211
178 D A -1.9717
179 C A 0.0000
180 V A 0.0000
181 N A -2.2072
182 I A -1.0356
183 T A 0.0000
184 V A -1.0780
185 K A -1.4140
186 Q A -0.4372
187 H A -0.3264
188 T A -0.3547
189 V A 0.5042
190 T A -0.2958
191 T A -1.3222
192 T A -1.1365
193 T A -1.0907
194 K A -2.4276
195 G A -2.2573
196 E A -2.8558
197 N A -2.3297
198 F A -1.2954
199 T A -1.2172
200 E A -2.1738
201 T A -1.1728
202 D A 0.0000
203 I A -1.3589
204 K A -2.5271
205 I A 0.0000
206 M A 0.0000
207 E A -2.4875
208 R A -2.3660
209 V A 0.0000
210 V A 0.0000
211 E A -1.9233
212 Q A -1.1622
213 M A 0.0000
214 C A 0.0000
215 I A -0.8441
216 T A -0.8969
217 Q A -1.3650
218 Y A -1.6259
219 Q A -2.3305
220 R A -2.7144
221 E A -1.7841
222 S A -1.6873
223 Q A -1.9437
224 A A -1.1039
225 Y A -0.2523
226 Y A -0.1395
227 Q A -1.6926
228 R A -2.2877
229 G A -1.5219
230 A A -0.7582

 

Laboratory of Theory of Biopolymers 2015