Project name: 85f059c11fa2279

Status: done

submitted: 2017-11-14 10:16:20, status changed: 2017-11-14 11:41:56
Settings
Chain sequence(s) A: ELQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGQPPKLLISPVQYLRWGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: ELQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGQPPKLLISPVQYLRWGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.932
Maximal score value
2.1696
Average score
-0.7589
Total score value
-1018.4809

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.4136
2 L A 0.2238
3 Q A 0.0000
4 M A -0.2114
5 T A 0.0000
6 Q A -1.0709
7 S A -0.8459
8 P A -1.0533
9 S A -0.9999
10 S A -0.9825
11 L A -0.6463
12 S A -0.9370
13 A A -0.9232
14 S A -0.7637
15 V A 0.2769
16 G A -0.7923
17 D A -1.7746
18 R A -2.5447
19 V A 0.0000
20 T A -0.6822
21 I A 0.0000
22 T A -0.6272
23 C A 0.0000
24 R A -1.2084
25 T A 0.0000
26 S A -0.9868
27 Q A -1.6195
28 S A -1.0516
29 I A 0.0000
30 S A 0.1505
31 S A 0.4746
32 Y A 1.3445
33 L A 0.0000
34 N A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.5542
39 K A -2.4867
40 P A -1.8451
41 G A -1.5896
42 Q A -2.1566
43 P A -1.5096
44 P A 0.0000
45 K A -0.9731
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 S A 0.6166
50 P A 0.6132
51 V A 0.5073
52 Q A 0.2728
53 Y A 1.4589
54 L A 0.8641
55 R A 0.8365
56 W A 1.3737
57 G A 0.1106
58 V A -0.1974
59 P A -1.5881
60 D A -2.7119
61 R A -3.0382
62 F A 0.0000
63 S A -0.7843
64 G A 0.0000
65 S A -0.2629
66 G A -0.5397
67 S A -0.4684
68 G A -0.8060
69 T A -1.2650
70 D A -1.4014
71 F A 0.0000
72 T A -0.5481
73 L A 0.0000
74 T A -0.7881
75 I A 0.0000
76 S A -2.0827
77 S A -1.4903
78 L A 0.0000
79 Q A -1.0925
80 P A -1.6119
81 E A -2.4214
82 D A 0.0000
83 S A -1.6320
84 A A 0.0000
85 T A -1.2599
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 S A 0.0000
92 Y A 0.5270
93 D A -1.0019
94 I A -0.0426
95 P A -0.3640
96 Y A -0.2070
97 T A -0.2828
98 F A 0.0000
99 G A 0.0000
100 Q A -1.7031
101 G A -1.4626
102 T A 0.0000
103 K A -1.8137
104 L A 0.0000
105 E A -1.4372
106 I A -1.0976
107 K A -1.2067
108 R A -1.0242
109 T A 0.0494
110 V A 1.0673
111 A A 0.4075
112 A A 0.0706
113 P A -0.3178
114 S A -0.3346
115 V A 0.0000
116 F A 0.0116
117 I A 0.0000
118 F A 0.0000
119 P A -0.5267
120 P A 0.0000
121 S A -1.5049
122 D A -2.7698
123 E A -2.3614
124 Q A 0.0000
125 L A -1.9670
126 K A -2.7277
127 S A -1.6503
128 G A -1.1663
129 T A -0.8991
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -1.1012
139 F A 0.0000
140 Y A 0.0000
141 P A -1.7459
142 R A -3.2179
143 E A -3.3040
144 A A -2.5217
145 K A -2.5640
146 V A -1.4194
147 Q A -1.3467
148 W A 0.0000
149 K A -0.7145
150 V A -0.8727
151 D A -1.6967
152 N A -1.3235
153 A A -0.3827
154 L A 0.3266
155 Q A -1.0878
156 S A -0.8505
157 G A -1.2627
158 N A -1.8781
159 S A -1.5914
160 Q A -1.3051
161 E A -1.8068
162 S A 0.0000
163 V A -0.7722
164 T A 0.0000
165 E A -2.3533
166 Q A -2.4414
167 D A -2.4584
168 S A -2.4068
169 K A -2.7564
170 D A -2.8100
171 S A -2.4935
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A -0.7097
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5110
181 L A -0.6955
182 S A -1.2254
183 K A -1.9223
184 A A -2.0028
185 D A -2.8044
186 Y A 0.0000
187 E A -2.8278
188 K A -3.3868
189 H A -2.8641
190 K A -3.0245
191 V A -1.7178
192 Y A 0.0000
193 A A -1.2054
194 C A 0.0000
195 E A -1.2973
196 V A 0.0000
197 T A -1.2330
198 H A 0.0000
199 Q A -1.7729
200 G A -0.4125
201 L A -0.1354
202 S A -0.4379
203 S A -0.3629
204 P A -0.6765
205 V A -0.2084
206 T A -0.8616
207 K A -1.4398
208 S A -1.1515
209 F A 0.0000
210 N A -2.2951
211 R A -2.5216
212 G A -1.9982
213 E A -2.5025
214 C A -2.3460
215 E B -1.4078
216 V B 0.1483
217 Q B -0.7248
218 L B 0.0000
219 L B 0.7345
220 E B 0.0000
221 S B -0.4623
222 G B -0.8820
223 G B -0.6726
224 G B -0.2008
225 V B 0.2054
226 V B 0.0000
227 Q B -2.0135
228 P B -2.1962
229 G B -2.3543
230 R B -2.8799
231 S B -2.2778
232 L B -1.5972
233 R B -2.1597
234 L B 0.0000
235 S B 0.0000
236 C B 0.0000
237 A B -0.1410
238 A B -0.3327
239 S B -0.5930
240 G B -0.3790
241 F B 0.2010
242 T B 0.0724
243 F B 0.0000
244 S B -0.7318
245 S B 0.0842
246 Y B 0.5450
247 G B 0.3067
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -0.9856
254 A B 0.0000
255 P B -1.0818
256 G B -1.4833
257 K B -2.4654
258 G B -1.7631
259 L B -1.1063
260 E B -1.3628
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.0000
265 I B 0.0000
266 S B -0.5139
267 Y B -0.0616
268 D B -1.7134
269 G B -1.5074
270 S B -1.2832
271 N B -1.5055
272 K B -0.6274
273 Y B 0.5036
274 Y B -0.3808
275 A B -1.1760
276 D B -2.7129
277 S B -2.2576
278 V B 0.0000
279 K B -2.9684
280 G B -2.4293
281 R B -3.2314
282 F B 0.0000
283 T B -1.4152
284 I B 0.0000
285 S B -0.5519
286 R B -1.0960
287 D B -1.9430
288 N B -1.7326
289 S B -1.6578
290 K B -2.5129
291 N B -1.9204
292 T B -1.0563
293 L B 0.0000
294 Y B -0.5897
295 L B 0.0000
296 Q B -1.8100
297 M B 0.0000
298 N B -2.5462
299 S B -2.1899
300 L B 0.0000
301 R B -3.2842
302 A B -2.0779
303 E B -2.4965
304 D B 0.0000
305 T B -0.8316
306 A B 0.0000
307 V B -0.0694
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 D B 0.4813
314 M B 0.0000
315 G B 0.0000
316 W B 1.6792
317 G B 1.2537
318 S B 1.1966
319 G B 0.6861
320 W B 0.9376
321 R B 0.0295
322 P B 0.2473
323 Y B 1.5151
324 Y B 1.6566
325 Y B 1.9501
326 Y B 1.2660
327 G B 0.0000
328 M B 0.0000
329 D B 0.2137
330 V B -0.0063
331 W B 0.0000
332 G B 0.0000
333 Q B -1.1539
334 G B -0.5296
335 T B -0.2828
336 T B -0.3159
337 V B 0.0000
338 T B -0.3432
339 V B 0.0000
340 S B -0.8573
341 S B -0.6663
342 A B -0.5690
343 S B -0.8581
344 T B -1.1263
345 K B -1.9365
346 G B -1.5459
347 P B -0.7114
348 S B -0.3895
349 V B 0.0000
350 F B -0.4722
351 P B -0.9303
352 L B 0.0000
353 A B -0.7827
354 P B -0.7848
355 S B -1.2565
356 S B -1.5400
357 K B -2.0722
358 S B -1.4662
359 T B -0.9660
360 S B -0.9624
361 G B -0.7693
362 G B -0.7005
363 T B -0.5209
364 A B -0.3733
365 A B 0.0000
366 L B 0.0000
367 G B 0.0000
368 C B 0.0000
369 L B 0.0000
370 V B 0.0000
371 K B -0.2629
372 D B -0.6583
373 Y B 0.0000
374 F B 0.0000
375 P B 0.0000
376 E B -1.5800
377 P B -1.3077
378 V B -0.8496
379 T B -0.5941
380 V B -0.2624
381 S B -0.2353
382 W B 0.0000
383 N B -0.5041
384 S B -0.5538
385 G B -0.2909
386 A B -0.1139
387 L B 0.1100
388 T B -0.0610
389 S B -0.1079
390 G B -0.2238
391 V B 0.3504
392 H B -0.1227
393 T B 0.0795
394 F B 0.0000
395 P B -0.2700
396 A B 0.2190
397 V B 0.4236
398 L B 0.7826
399 Q B -0.1577
400 S B -0.2634
401 S B -0.0488
402 G B -0.4919
403 L B -0.0483
404 Y B -0.0509
405 S B 0.0000
406 L B 0.0634
407 S B 0.0000
408 S B 0.0000
409 V B 0.0000
410 V B 0.0000
411 T B -0.0668
412 V B 0.0000
413 P B -0.5953
414 S B -0.6566
415 S B -0.7154
416 S B -0.8643
417 L B 0.0000
418 G B -1.2671
419 T B -0.9736
420 Q B -1.4397
421 T B -1.1183
422 Y B 0.0000
423 I B -0.7435
424 C B 0.0000
425 N B -1.2718
426 V B 0.0000
427 N B -1.8557
428 H B 0.0000
429 K B -2.7448
430 P B -1.7613
431 S B -1.9840
432 N B -2.4222
433 T B -2.1069
434 K B -2.5778
435 V B -1.6412
436 D B -2.2702
437 K B -1.5384
438 K B -1.5059
439 V B 0.0000
440 E B -2.4424
441 P B -1.8926
442 K B -2.7020
443 S B -2.5078
444 C B -2.4592
445 D B -3.6660
446 K B -3.1750
447 T B -1.8487
448 H B -2.1717
449 T B -2.3284
450 C B 0.0000
451 P B -1.6926
452 P B 0.0000
453 C B -0.5219
454 P B -0.5869
455 A B -0.5885
456 P B -0.6880
457 E B -0.7471
458 L B 1.0566
459 L B 1.5998
460 G B 0.4442
461 G B 0.0010
462 P B 0.0000
463 S B 0.0082
464 V B 0.0000
465 F B 0.8812
466 L B 0.0000
467 F B 0.7723
468 P B -0.2210
469 P B 0.0000
470 K B -2.0279
471 P B -1.2101
472 K B -1.0906
473 D B -1.2799
474 T B 0.0000
475 L B 0.0000
476 M B 0.4930
477 I B 1.6230
478 S B 0.0058
479 R B -1.2437
480 T B -0.4973
481 P B 0.0000
482 E B -1.2211
483 V B 0.0000
484 T B 0.4197
485 C B 0.0000
486 V B 0.0000
487 V B 0.0000
488 V B -0.3328
489 D B -0.9134
490 V B 0.0000
491 S B -1.8354
492 H B -2.1755
493 E B -2.8327
494 D B 0.0000
495 P B -2.5399
496 E B -3.2347
497 V B 0.0000
498 K B -2.5973
499 F B 0.0000
500 N B -1.3881
501 W B 0.0000
502 Y B -1.3019
503 V B -1.0923
504 D B -2.2083
505 G B -0.9677
506 V B 0.5690
507 E B -0.8742
508 V B 0.0381
509 H B -1.2831
510 N B -1.2090
511 A B -1.1029
512 K B -2.1202
513 T B -1.5205
514 K B -2.4686
515 P B -2.1182
516 R B -3.5540
517 E B -3.4215
518 E B -3.3409
519 Q B -2.7046
520 Y B -1.5352
521 N B -1.5563
522 S B -1.1919
523 T B -1.5849
524 Y B -2.2449
525 R B -2.0873
526 V B 0.0000
527 V B -0.8735
528 S B 0.0000
529 V B -0.1118
530 L B 0.0000
531 T B -0.2846
532 V B 0.4434
533 L B 0.9931
534 H B 0.0000
535 Q B -1.0289
536 D B -1.0046
537 W B 0.0000
538 L B -0.9312
539 N B -1.8702
540 G B -2.1218
541 K B -2.3346
542 E B -2.3426
543 Y B 0.0000
544 K B -1.9142
545 C B 0.0000
546 K B -1.8361
547 V B 0.0000
548 S B -1.5207
549 N B -1.8898
550 K B -2.0521
551 A B -1.2063
552 L B -0.5584
553 P B -0.4435
554 A B -0.4115
555 P B -0.6440
556 I B -0.6359
557 E B -1.6253
558 K B -1.4106
559 T B -1.2190
560 I B -0.1542
561 S B -1.5271
562 K B -1.3912
563 A B -1.2503
564 K B -2.3313
565 G B -2.0671
566 Q B -2.1115
567 P B -2.0771
568 R B -2.4875
569 E B -2.5014
570 P B 0.0000
571 Q B -1.2609
572 V B 0.0000
573 Y B 0.0000
574 T B -0.7775
575 L B 0.0000
576 P B -0.3756
577 P B 0.0000
578 S B -1.3918
579 R B -2.6017
580 D B -2.7600
581 E B 0.0000
582 L B -1.4575
583 T B -1.5209
584 K B -2.5059
585 N B -2.8357
586 Q B -2.8117
587 V B 0.0000
588 S B 0.0000
589 L B 0.0000
590 T B 0.0000
591 C B 0.0000
592 L B 0.0000
593 V B 0.0000
594 K B -0.5622
595 G B -1.0032
596 F B 0.0000
597 Y B -1.1912
598 P B 0.0000
599 S B 0.0439
600 D B -0.7329
601 I B 0.0000
602 A B 0.0000
603 V B 0.0000
604 E B -1.3986
605 W B 0.0000
606 E B -1.8742
607 S B 0.0000
608 N B -1.8427
609 G B -1.7565
610 Q B -2.1862
611 P B -2.0260
612 E B -2.2611
613 N B -2.1482
614 N B -1.7166
615 Y B -1.0841
616 K B -0.7090
617 T B -0.4354
618 T B 0.0000
619 P B 0.0272
620 P B 0.2995
621 V B 0.7876
622 L B 1.0240
623 D B -0.2952
624 S B -1.1894
625 D B -1.8841
626 G B -0.7492
627 S B 0.0000
628 F B 0.2242
629 F B 0.0000
630 L B 0.0000
631 Y B 0.0000
632 S B 0.0000
633 K B 0.0000
634 L B 0.0000
635 T B -1.0788
636 V B 0.0000
637 D B -2.9100
638 K B -2.6816
639 S B -2.1951
640 R B -2.2285
641 W B -1.9260
642 Q B -2.4348
643 Q B -2.3067
644 G B -1.2178
645 N B -0.9805
646 V B -0.1963
647 F B 0.0000
648 S B -1.1488
649 C B 0.0000
650 S B -0.9305
651 V B 0.0000
652 M B -0.6723
653 H B 0.0000
654 E B -1.1157
655 A B -1.7685
656 L B 0.0000
657 H B -1.8361
658 N B -1.7373
659 H B -1.2726
660 Y B -0.7654
661 T B -1.1412
662 Q B -1.4460
663 K B -1.1816
664 S B -0.4143
665 L B 0.0000
666 S B 0.2402
667 L B 1.1681
668 S B 0.2967
669 P B -0.1001
670 G B -0.3815
671 K B -0.6661
672 E C -1.4162
673 L C 0.0824
674 Q C 0.0000
675 M C -0.7625
676 T C 0.0000
677 Q C -1.4951
678 S C -0.8218
679 P C -1.0607
680 S C -0.9502
681 S C -0.6955
682 L C -0.3393
683 S C -0.7789
684 A C 0.0000
685 S C -1.1745
686 V C -0.4833
687 G C -1.0990
688 D C -2.1208
689 R C -2.4825
690 V C 0.0000
691 T C -0.7038
692 I C 0.0000
693 T C -1.0197
694 C C 0.0000
695 R C -2.2650
696 T C 0.0000
697 S C -1.2224
698 Q C -1.8871
699 S C -1.2792
700 I C 0.0000
701 S C -0.2179
702 S C 0.0608
703 Y C 0.6122
704 L C 0.0000
705 N C 0.0000
706 W C 0.0000
707 Y C 0.0000
708 Q C 0.0000
709 Q C -1.8908
710 K C -2.8903
711 P C -1.9614
712 G C -1.6871
713 Q C -2.4919
714 P C -1.8427
715 P C 0.0000
716 K C -1.9052
717 L C 0.0000
718 L C 0.0000
719 I C 0.0000
720 S C 0.0000
721 P C 0.5945
722 V C 0.4258
723 Q C 0.4148
724 Y C 1.6008
725 L C 1.1376
726 R C 0.0000
727 W C 1.3592
728 G C 0.1219
729 V C 0.1652
730 P C -0.9944
731 D C -1.9279
732 R C -1.5166
733 F C 0.0000
734 S C -0.3683
735 G C 0.0000
736 S C -0.3950
737 G C -0.9345
738 S C -0.8500
739 G C -1.2114
740 T C -1.7422
741 D C -2.2103
742 F C 0.0000
743 T C -0.7975
744 L C 0.0000
745 T C -0.5778
746 I C 0.0000
747 S C -1.6513
748 S C -1.2971
749 L C 0.0000
750 Q C -1.0640
751 P C -1.6057
752 E C -2.3336
753 D C 0.0000
754 S C -1.4984
755 A C 0.0000
756 T C -1.0997
757 Y C 0.0000
758 Y C 0.0000
759 C C 0.0000
760 Q C 0.0000
761 Q C 0.0000
762 S C 0.1923
763 Y C 0.3822
764 D C -1.1617
765 I C -0.2399
766 P C -0.5370
767 Y C -0.3209
768 T C -0.4854
769 F C 0.0000
770 G C 0.0000
771 Q C -1.8129
772 G C -1.3704
773 T C 0.0000
774 K C -1.3789
775 L C 0.0000
776 E C 0.0000
777 I C 0.0000
778 K C -1.6984
779 R C -1.6662
780 T C -0.1931
781 V C 0.9718
782 A C 0.3312
783 A C 0.0541
784 P C -0.3125
785 S C -0.3634
786 V C 0.0000
787 F C 0.1037
788 I C 0.0000
789 F C 0.0000
790 P C 0.0000
791 P C 0.0000
792 S C 0.0000
793 D C -2.5420
794 E C -2.0558
795 Q C 0.0000
796 L C -2.0244
797 K C -2.5506
798 S C -1.5808
799 G C -1.1985
800 T C -0.9527
801 A C 0.0000
802 S C 0.0000
803 V C 0.0000
804 V C 0.0000
805 C C 0.0000
806 L C 0.0000
807 L C 0.0000
808 N C 0.0000
809 N C -1.2822
810 F C 0.0000
811 Y C 0.0000
812 P C -1.5414
813 R C -2.4767
814 E C -3.0280
815 A C -2.3396
816 K C -2.4098
817 V C -1.2374
818 Q C -1.1329
819 W C 0.0000
820 K C -0.6159
821 V C -0.9451
822 D C -1.4777
823 N C -1.2907
824 A C -0.3453
825 L C 0.3035
826 Q C -1.0675
827 S C -0.9153
828 G C -1.2931
829 N C -2.0255
830 S C -1.5766
831 Q C -1.1497
832 E C -1.5091
833 S C 0.0000
834 V C 0.4368
835 T C -0.5863
836 E C -2.0516
837 Q C -2.3885
838 D C -2.9733
839 S C -2.6857
840 K C -3.0351
841 D C -3.3700
842 S C 0.0000
843 T C -2.1423
844 Y C 0.0000
845 S C 0.0000
846 L C -0.1120
847 S C 0.0000
848 S C 0.0000
849 T C 0.0000
850 L C 0.0000
851 T C -0.5429
852 L C -0.7489
853 S C -1.4186
854 K C -2.3248
855 A C -2.3688
856 D C -3.0239
857 Y C 0.0000
858 E C -3.9320
859 K C -3.7717
860 H C -3.1740
861 K C -3.2150
862 V C -1.4532
863 Y C 0.0000
864 A C -0.8731
865 C C 0.0000
866 E C -0.9466
867 V C 0.0000
868 T C -1.1374
869 H C 0.0000
870 Q C -1.7347
871 G C -0.4252
872 L C -0.1295
873 S C -0.4245
874 S C -0.3285
875 P C -0.4292
876 V C 0.0965
877 T C -0.4598
878 K C -0.8034
879 S C -0.7146
880 F C 0.0000
881 N C -1.9640
882 R C -2.4480
883 G C -1.7934
884 E C -1.5514
885 C C -0.8794
886 E D 0.3067
887 V D 1.0615
888 Q D -0.0849
889 L D 0.0000
890 L D 0.7836
891 E D 0.0000
892 S D -0.4573
893 G D -0.8823
894 G D -0.6210
895 G D -0.0403
896 V D 0.4251
897 V D -0.6055
898 Q D -1.7873
899 P D -1.7766
900 G D -1.9072
901 R D -2.6239
902 S D -2.0767
903 L D -1.5521
904 R D -2.1381
905 L D 0.0000
906 S D -0.5164
907 C D 0.0000
908 A D -0.0866
909 A D 0.0000
910 S D -0.2941
911 G D 0.1001
912 F D 0.3092
913 T D 0.0091
914 F D 0.0000
915 S D -0.5405
916 S D 0.0000
917 Y D 1.0438
918 G D 0.0000
919 M D 0.0000
920 H D 0.0000
921 W D 0.0000
922 V D 0.0000
923 R D 0.0000
924 Q D -1.1718
925 A D -1.3907
926 P D -1.0445
927 G D -1.4584
928 K D -2.5491
929 G D -1.9226
930 L D -1.4670
931 E D -2.1054
932 W D 0.0000
933 V D 0.0000
934 A D 0.0000
935 V D 0.0000
936 I D 0.0000
937 S D -0.5860
938 Y D 0.0549
939 D D -1.7512
940 G D -1.5991
941 S D -1.4435
942 N D -1.8285
943 K D -1.1807
944 Y D -0.0252
945 Y D -0.7320
946 A D -1.2918
947 D D -2.5861
948 S D -1.9464
949 V D 0.0000
950 K D -2.8358
951 G D -2.1974
952 R D -2.6024
953 F D 0.0000
954 T D -1.2875
955 I D 0.0000
956 S D -0.7510
957 R D -1.0811
958 D D -1.6429
959 N D -1.7417
960 S D -1.6337
961 K D -2.4518
962 N D -1.8441
963 T D -0.9908
964 L D 0.0000
965 Y D -0.5031
966 L D 0.0000
967 Q D -1.5613
968 M D 0.0000
969 N D -2.0474
970 S D -1.6734
971 L D 0.0000
972 R D -2.0093
973 A D -1.4483
974 E D -2.0498
975 D D 0.0000
976 T D -0.5816
977 A D 0.0000
978 V D -0.0474
979 Y D 0.0000
980 Y D 0.0000
981 C D 0.0000
982 A D 0.0000
983 K D 0.0000
984 D D 0.3558
985 M D 0.6947
986 G D 1.0319
987 W D 1.3498
988 G D 0.2701
989 S D -0.2506
990 G D -0.6109
991 W D 0.0812
992 R D -1.1950
993 P D -0.0710
994 Y D 1.6604
995 Y D 2.1696
996 Y D 1.5912
997 Y D 0.7961
998 G D 0.0000
999 M D 0.0000
1000 D D -0.3926
1001 V D -0.2793
1002 W D 0.0000
1003 G D 0.0000
1004 Q D -1.1505
1005 G D -0.5390
1006 T D -0.2719
1007 T D -0.2216
1008 V D 0.0000
1009 T D -0.1821
1010 V D 0.0000
1011 S D -0.6765
1012 S D -0.6408
1013 A D -0.5029
1014 S D -0.7158
1015 T D -0.9437
1016 K D -1.7588
1017 G D -1.7581
1018 P D -1.0473
1019 S D -0.5464
1020 V D 0.0000
1021 F D -0.5304
1022 P D 0.0000
1023 L D 0.0000
1024 A D 0.0000
1025 P D -0.6559
1026 S D 0.0000
1027 S D -1.1270
1028 K D -1.9833
1029 S D -1.2332
1030 T D -0.9736
1031 S D -0.9061
1032 G D -0.7712
1033 G D -0.6982
1034 T D -0.5118
1035 A D 0.0000
1036 A D 0.0301
1037 L D 0.0000
1038 G D 0.0000
1039 C D 0.0000
1040 L D 0.0000
1041 V D 0.0000
1042 K D -0.5631
1043 D D -1.4188
1044 Y D 0.0000
1045 F D 0.0000
1046 P D 0.0000
1047 E D -0.7522
1048 P D -0.9322
1049 V D -0.8829
1050 T D -0.6095
1051 V D -0.3223
1052 S D -0.3309
1053 W D 0.0000
1054 N D -0.7228
1055 S D -0.6345
1056 G D -0.4420
1057 A D -0.1872
1058 L D 0.0096
1059 T D -0.1062
1060 S D -0.1107
1061 G D -0.2400
1062 V D 0.3590
1063 H D -0.0224
1064 T D 0.2032
1065 F D 0.0000
1066 P D 0.0791
1067 A D 0.4460
1068 V D 0.9692
1069 L D 1.1268
1070 Q D -0.5652
1071 S D -0.4457
1072 S D -0.4943
1073 G D 0.0000
1074 L D -0.2578
1075 Y D 0.0285
1076 S D 0.0000
1077 L D 0.0947
1078 S D 0.0000
1079 S D 0.0000
1080 V D 0.0000
1081 V D 0.0000
1082 T D -0.0609
1083 V D 0.0000
1084 P D -0.5073
1085 S D -0.5710
1086 S D -0.6655
1087 S D -0.7484
1088 L D -0.8686
1089 G D -1.1328
1090 T D -0.8947
1091 Q D -1.3565
1092 T D -1.2850
1093 Y D 0.0000
1094 I D -1.3080
1095 C D 0.0000
1096 N D -1.5630
1097 V D 0.0000
1098 N D -2.0739
1099 H D 0.0000
1100 K D -2.7874
1101 P D -1.7206
1102 S D -1.9239
1103 N D -2.5708
1104 T D -1.9996
1105 K D -2.6187
1106 V D -1.6040
1107 D D -2.6172
1108 K D -2.2393
1109 K D -2.8081
1110 V D 0.0000
1111 E D -2.6286
1112 P D -1.5891
1113 K D -1.3267
1114 S D -1.3806
1115 C D -1.0954
1116 D D -2.6069
1117 K D -2.4070
1118 T D -1.7488
1119 H D -1.4399
1120 T D -1.9144
1121 C D -1.5806
1122 P D -1.0179
1123 P D -0.8122
1124 C D -0.4219
1125 P D -0.6362
1126 A D 0.0000
1127 P D -1.1118
1128 E D -1.2999
1129 L D 0.1486
1130 L D 1.3327
1131 G D 0.0295
1132 G D -0.2191
1133 P D -0.0964
1134 S D 0.1835
1135 V D 0.0000
1136 F D 2.0703
1137 L D 1.6497
1138 F D 2.1482
1139 P D 0.5256
1140 P D 0.0000
1141 K D -1.8394
1142 P D -1.2321
1143 K D -0.9744
1144 D D -1.2473
1145 T D 0.0000
1146 L D 0.0000
1147 M D 0.5440
1148 I D 1.4528
1149 S D -0.0881
1150 R D -1.3082
1151 T D -0.6298
1152 P D 0.0000
1153 E D -0.7053
1154 V D 0.0000
1155 T D 1.1149
1156 C D 0.0000
1157 V D 0.9368
1158 V D 0.0000
1159 V D 0.1479
1160 D D -0.1876
1161 V D 0.0000
1162 S D -1.9016
1163 H D -2.4756
1164 E D -2.9432
1165 D D -2.4252
1166 P D -2.6029
1167 E D -3.1384
1168 V D 0.0000
1169 K D -2.5866
1170 F D 0.0000
1171 N D -1.4934
1172 W D 0.0000
1173 Y D -1.2049
1174 V D -0.8281
1175 D D -1.6036
1176 G D -0.6724
1177 V D 0.6133
1178 E D -1.0547
1179 V D -0.0921
1180 H D -1.3018
1181 N D -1.1192
1182 A D -1.0693
1183 K D -2.0097
1184 T D -1.2616
1185 K D -2.0392
1186 P D -1.8207
1187 R D -2.6152
1188 E D -2.7818
1189 E D -2.2737
1190 Q D -2.1348
1191 Y D -0.9793
1192 N D -1.0711
1193 S D -0.9389
1194 T D -0.9891
1195 Y D 0.0000
1196 R D -1.5388
1197 V D 0.0000
1198 V D -0.4865
1199 S D 0.0000
1200 V D 0.2862
1201 L D 0.0000
1202 T D -0.1981
1203 V D 0.5224
1204 L D 1.1121
1205 H D 0.0000
1206 Q D -0.9354
1207 D D -1.2070
1208 W D 0.0000
1209 L D -0.9264
1210 N D -2.0443
1211 G D -2.0130
1212 K D -2.1311
1213 E D -2.2585
1214 Y D 0.0000
1215 K D -1.7801
1216 C D 0.0000
1217 K D -1.7443
1218 V D 0.0000
1219 S D -1.4940
1220 N D -1.9124
1221 K D -2.1200
1222 A D -1.2920
1223 L D -0.6262
1224 P D -0.4973
1225 A D -0.3459
1226 P D -0.5155
1227 I D -0.4679
1228 E D -1.3342
1229 K D -1.0984
1230 T D -0.9922
1231 I D -0.0705
1232 S D -1.5652
1233 K D -1.4666
1234 A D -1.3371
1235 K D -2.3372
1236 G D -2.0814
1237 Q D -2.3082
1238 P D -2.1667
1239 R D -2.6074
1240 E D -2.8200
1241 P D 0.0000
1242 Q D -1.2895
1243 V D 0.0000
1244 Y D 0.0000
1245 T D -0.6072
1246 L D -0.2804
1247 P D -0.2945
1248 P D -0.7731
1249 S D -1.4001
1250 R D -2.6154
1251 D D -2.7465
1252 E D 0.0000
1253 L D -1.3466
1254 T D -1.3933
1255 K D -2.3007
1256 N D -2.6332
1257 Q D -2.5713
1258 V D 0.0000
1259 S D 0.0000
1260 L D 0.0000
1261 T D 0.0000
1262 C D 0.0000
1263 L D 0.0000
1264 V D 0.0000
1265 K D 0.0000
1266 G D -0.8978
1267 F D 0.0000
1268 Y D -1.2485
1269 P D 0.0000
1270 S D -0.1588
1271 D D -0.9279
1272 I D 0.0000
1273 A D -0.4929
1274 V D 0.0000
1275 E D -1.0425
1276 W D 0.0000
1277 E D -1.7508
1278 S D 0.0000
1279 N D -2.1388
1280 G D -1.8705
1281 Q D -2.1381
1282 P D -1.7993
1283 E D -1.8095
1284 N D -1.8501
1285 N D -1.5160
1286 Y D -0.9124
1287 K D -0.6753
1288 T D -0.4084
1289 T D 0.0000
1290 P D 0.0133
1291 P D 0.3346
1292 V D 0.8832
1293 L D 1.0956
1294 D D -0.2958
1295 S D -1.2878
1296 D D -1.9917
1297 G D -0.9194
1298 S D 0.0000
1299 F D 0.3154
1300 F D 0.0000
1301 L D 0.0000
1302 Y D 0.0000
1303 S D 0.0000
1304 K D 0.0000
1305 L D 0.0000
1306 T D -0.9215
1307 V D 0.0000
1308 D D -2.8185
1309 K D -2.6425
1310 S D -2.3032
1311 R D -2.6386
1312 W D -2.1248
1313 Q D -2.4142
1314 Q D -2.3416
1315 G D -1.3942
1316 N D -1.3353
1317 V D -0.4631
1318 F D 0.0000
1319 S D -1.0084
1320 C D 0.0000
1321 S D -0.5966
1322 V D 0.0000
1323 M D -0.5325
1324 H D 0.0000
1325 E D -1.1844
1326 A D -1.8661
1327 L D 0.0000
1328 H D -1.8180
1329 N D -1.7263
1330 H D -1.2029
1331 Y D -0.5190
1332 T D -0.8594
1333 Q D -0.8867
1334 K D -0.9569
1335 S D -0.3213
1336 L D 0.0000
1337 S D 0.0777
1338 L D 0.8563
1339 S D 0.2068
1340 P D -0.2258
1341 G D -0.4429
1342 K D -0.6664

 

Laboratory of Theory of Biopolymers 2015