Project name: 8610dd5f704a0bc

Status: done

submitted: 2017-11-14 10:16:34, status changed: 2017-11-14 10:43:17
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYTSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCIILMLAGGLFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYTSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCIILMLAGGLFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIGYISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSLARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIGYISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSLARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7681
Maximal score value
2.2289
Average score
-0.7314
Total score value
-968.4192

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -0.4637
2 I A 0.7147
3 Q A 0.0000
4 M A -0.5089
5 T A 0.0000
6 Q A -1.3299
7 S A -0.8039
8 P A -1.0096
9 S A -0.9309
10 S A -0.8636
11 L A -0.5374
12 S A -0.8216
13 A A -0.8106
14 S A -0.6775
15 V A 0.3785
16 G A -0.6629
17 D A -1.7040
18 R A -2.4105
19 V A 0.0000
20 T A -0.7054
21 I A 0.0000
22 T A -0.9868
23 C A 0.0000
24 R A -2.4874
25 A A 0.0000
26 S A -1.3500
27 Q A -2.5076
28 D A -2.8707
29 I A 0.0000
30 S A -0.3904
31 S A 0.3404
32 Y A 1.4106
33 L A 0.0000
34 N A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.8476
39 K A -2.7381
40 P A -2.0311
41 G A -1.8723
42 K A -2.8732
43 A A -1.9026
44 P A 0.0000
45 K A -1.6918
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.7367
50 Y A 1.3148
51 T A 0.3605
52 S A -0.3034
53 R A -1.1827
54 L A -0.0882
55 H A -0.4022
56 S A -0.5200
57 G A -0.4353
58 V A -0.4498
59 P A -0.8455
60 S A -0.9194
61 R A -1.9551
62 F A 0.0000
63 S A -0.7614
64 G A -0.2184
65 S A -0.5356
66 G A -0.6915
67 S A -0.9314
68 G A -1.7814
69 T A -2.1966
70 D A -2.2878
71 F A 0.0000
72 T A -0.7941
73 F A 0.0000
74 T A -0.7834
75 I A 0.0000
76 S A -1.6817
77 S A -1.2901
78 L A 0.0000
79 Q A -0.8977
80 P A -1.5012
81 E A -2.3076
82 D A 0.0000
83 I A -1.2557
84 A A 0.0000
85 T A -1.0794
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 I A 0.0000
90 I A 0.0000
91 L A 1.1191
92 M A 0.8585
93 L A 1.2227
94 A A 0.5522
95 G A 0.1989
96 G A 0.0000
97 L A 0.6775
98 F A 0.0000
99 G A 0.0000
100 Q A -1.6017
101 G A -1.4326
102 T A 0.0000
103 K A -1.4814
104 V A 0.0000
105 E A -1.0726
106 I A -0.8804
107 K A -1.2799
108 R A -1.0402
109 T A 0.0238
110 V A 1.0483
111 A A 0.4276
112 A A 0.0960
113 P A -0.2713
114 S A -0.2065
115 V A 0.0000
116 F A 0.2421
117 I A 0.0000
118 F A 0.0000
119 P A 0.0000
120 P A 0.0000
121 S A 0.0000
122 D A -3.2305
123 E A -3.2698
124 Q A 0.0000
125 L A 0.0000
126 K A -3.1418
127 S A -1.8062
128 G A -1.1826
129 T A -0.7676
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -0.9352
139 F A 0.0000
140 Y A 0.0000
141 P A -1.7284
142 R A -3.2029
143 E A -3.2693
144 A A -2.4574
145 K A -2.5138
146 V A 0.0000
147 Q A -0.9437
148 W A 0.0000
149 K A -0.5939
150 V A -0.8699
151 D A -1.5342
152 N A -1.3134
153 A A -0.3240
154 L A 0.3700
155 Q A -1.0234
156 S A -0.8820
157 G A -1.3177
158 N A -2.0220
159 S A -1.6459
160 Q A -1.3443
161 E A -2.0773
162 S A 0.0000
163 V A -0.7940
164 T A -1.1734
165 E A -2.3160
166 Q A 0.0000
167 D A -2.5818
168 S A -2.4559
169 K A -2.7498
170 D A -2.7084
171 S A -2.4083
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A 0.0000
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5348
181 L A -0.6190
182 S A -0.9735
183 K A -1.4549
184 A A -1.5001
185 D A -2.0698
186 Y A 0.0000
187 E A -2.4375
188 K A -3.0545
189 H A -2.5927
190 K A -2.6053
191 V A -1.1884
192 Y A 0.0000
193 A A -0.8407
194 C A 0.0000
195 E A -0.9935
196 V A 0.0000
197 T A -1.1525
198 H A 0.0000
199 Q A -1.7829
200 G A -0.4492
201 L A -0.1748
202 S A -0.4555
203 S A -0.4035
204 P A -0.5563
205 V A -0.1324
206 T A -0.5816
207 K A -0.8949
208 S A -0.5756
209 F A -0.8416
210 N A -1.3049
211 R A -1.8374
212 G A 0.0000
213 E A -2.1196
214 C A -1.6718
215 Q B -1.3463
216 V B -0.7646
217 Q B -1.5670
218 L B 0.0000
219 Q B -1.5998
220 E B -1.1037
221 S B -0.7478
222 G B -0.4421
223 P B 0.0000
224 G B 0.1062
225 L B 0.0073
226 V B 0.0000
227 R B -2.2100
228 P B -1.4625
229 S B -1.3262
230 Q B -1.6953
231 T B -1.1171
232 L B -0.5671
233 S B -0.5646
234 L B 0.0000
235 T B -0.5395
236 C B 0.0000
237 T B -1.0867
238 V B 0.0000
239 S B -0.7900
240 G B -0.4267
241 Y B 0.5935
242 S B -0.1065
243 I B 0.0000
244 T B -0.9918
245 S B -0.8870
246 D B -2.2071
247 H B -1.3540
248 A B 0.0000
249 W B 0.0000
250 S B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B 0.0000
254 Q B -0.8746
255 P B -0.9366
256 P B -1.1200
257 G B -1.5709
258 R B -2.6129
259 G B -1.7602
260 L B 0.0000
261 E B -1.1318
262 W B 0.0000
263 I B 0.0000
264 G B 0.0000
265 Y B 0.0000
266 I B 0.0000
267 S B 0.0000
268 Y B -0.5657
269 S B -0.1081
270 G B 0.6870
271 I B 1.8662
272 T B 1.1480
273 T B 0.4019
274 Y B -0.0479
275 N B -0.5879
276 P B -0.9754
277 S B -0.8343
278 L B 0.0000
279 K B -1.9253
280 S B -1.2171
281 R B -1.2760
282 V B 0.0000
283 T B -0.5056
284 M B 0.0000
285 L B 0.4011
286 R B -0.6059
287 D B -1.4799
288 T B -1.3305
289 S B -1.5634
290 K B -2.4599
291 N B -1.8292
292 Q B -1.4945
293 F B 0.0000
294 S B 0.0000
295 L B 0.0000
296 R B -0.9310
297 L B 0.0000
298 S B -0.9146
299 S B -0.8200
300 V B 0.0000
301 T B -0.5560
302 A B -0.3410
303 A B 0.0297
304 D B 0.0000
305 T B 0.2326
306 A B 0.0000
307 V B 0.5642
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 R B -0.3860
313 S B 0.0000
314 L B 0.0000
315 A B -0.6393
316 R B -2.1799
317 T B 0.0000
318 T B -0.7025
319 A B 0.0000
320 M B 0.0000
321 D B 0.0000
322 Y B -0.0788
323 W B 0.0000
324 G B 0.0000
325 Q B -1.9852
326 G B -0.8877
327 S B -0.0621
328 L B 0.9310
329 V B 0.0000
330 T B 0.0437
331 V B 0.0000
332 S B -0.7351
333 S B -0.9355
334 A B -0.7783
335 S B -1.0117
336 T B -1.1570
337 K B -2.0951
338 G B -1.8211
339 P B -0.9479
340 S B -0.5291
341 V B 0.0000
342 F B 0.0000
343 P B -1.3911
344 L B 0.0000
345 A B -0.6844
346 P B -0.6796
347 S B -1.0019
348 S B -1.3703
349 K B -1.8512
350 S B -1.5575
351 T B -0.9609
352 S B -1.0168
353 G B -0.7816
354 G B -0.7245
355 T B -0.5108
356 A B -0.2831
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.7089
364 D B -0.8818
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.5827
369 P B -0.6741
370 V B -0.6378
371 T B -0.5574
372 V B 0.0687
373 S B -0.2675
374 W B 0.0000
375 N B -0.6787
376 S B -0.5695
377 G B -0.2993
378 A B -0.1187
379 L B 0.1299
380 T B -0.0577
381 S B -0.0883
382 G B -0.1375
383 V B 0.3573
384 H B -0.1205
385 T B 0.0395
386 F B 0.0000
387 P B -0.2360
388 A B 0.3956
389 V B 0.7483
390 L B 1.2871
391 Q B -0.2587
392 S B -0.2410
393 S B -0.4440
394 G B -0.0331
395 L B -0.0691
396 Y B 0.1371
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0470
404 V B 0.0000
405 P B -0.5674
406 S B -0.5946
407 S B -0.6643
408 S B -0.7742
409 L B -0.8911
410 G B -1.1567
411 T B -0.8777
412 Q B -1.2993
413 T B -1.2670
414 Y B 0.0000
415 I B -1.3088
416 C B 0.0000
417 N B -1.4701
418 V B 0.0000
419 N B -1.9704
420 H B 0.0000
421 K B -2.7106
422 P B -1.7387
423 S B -2.0103
424 N B -2.5175
425 T B -2.1193
426 K B -2.6266
427 V B -1.7077
428 D B -2.5719
429 K B -2.1278
430 K B -2.7235
431 V B 0.0000
432 E B -2.7369
433 P B -1.9024
434 K B -2.1867
435 S B -1.6335
436 C B -1.6572
437 D B -2.3113
438 K B -2.0801
439 T B 0.0000
440 H B -1.8233
441 T B -1.5867
442 C B 0.0000
443 P B -1.5424
444 P B -1.1316
445 C B 0.0000
446 P B -0.9683
447 A B -0.7484
448 P B -0.6801
449 E B -0.9331
450 L B 0.6666
451 L B 1.3725
452 G B 0.1953
453 G B -0.0814
454 P B -0.3094
455 S B 0.0041
456 V B 0.0000
457 F B 1.1341
458 L B 0.0000
459 F B 1.7663
460 P B 0.2098
461 P B 0.0000
462 K B -2.0825
463 P B -1.4045
464 K B -1.3202
465 D B -1.3949
466 T B 0.0000
467 L B 0.0000
468 M B 0.7440
469 I B 1.5485
470 S B 0.0995
471 R B -1.1162
472 T B -0.6588
473 P B 0.0000
474 E B -1.1415
475 V B 0.0000
476 T B 0.7800
477 C B 0.0000
478 V B 0.3892
479 V B 0.0000
480 V B -0.2843
481 D B -0.7736
482 V B 0.0000
483 S B -1.7698
484 H B -2.1738
485 E B -2.7381
486 D B 0.0000
487 P B -2.2082
488 E B -2.4687
489 V B 0.0000
490 K B -2.3501
491 F B -1.8186
492 N B -1.5004
493 W B 0.0000
494 Y B -0.8978
495 V B -0.3292
496 D B -0.9443
497 G B -0.2192
498 V B 0.9617
499 E B -0.7127
500 V B -0.0082
501 H B -1.3521
502 N B -1.3516
503 A B -1.1531
504 K B -2.1723
505 T B 0.0000
506 K B -2.4332
507 P B -1.9666
508 R B -2.9871
509 E B -2.9328
510 E B -2.6935
511 Q B -2.3424
512 Y B -1.2619
513 N B -1.4931
514 S B -1.2581
515 T B -1.4552
516 Y B -2.0113
517 R B -1.9264
518 V B 0.0000
519 V B -0.7691
520 S B 0.0000
521 V B 0.0044
522 L B 0.0000
523 T B -0.4013
524 V B 0.3869
525 L B 1.0565
526 H B -0.0017
527 Q B -0.9638
528 D B -1.1001
529 W B 0.0000
530 L B -0.9510
531 N B -2.0288
532 G B -1.9546
533 K B -1.9125
534 E B -1.8929
535 Y B 0.0000
536 K B -1.6173
537 C B 0.0000
538 K B -1.7487
539 V B 0.0000
540 S B -1.3725
541 N B -1.7339
542 K B -2.0601
543 A B -1.2193
544 L B -0.5615
545 P B -0.4316
546 A B -0.3626
547 P B -0.5184
548 I B -0.5414
549 E B -1.5832
550 K B -1.3998
551 T B -1.0091
552 I B -0.0461
553 S B -1.4332
554 K B -1.5176
555 A B -1.3466
556 K B -2.3565
557 G B -2.0777
558 Q B -2.1058
559 P B -2.1440
560 R B -2.5405
561 E B -2.6026
562 P B 0.0000
563 Q B -1.2684
564 V B 0.0000
565 Y B 0.0000
566 T B -0.7933
567 L B 0.0000
568 P B -0.4088
569 P B 0.0000
570 S B -1.3685
571 R B -2.5295
572 D B -2.6627
573 E B 0.0000
574 L B -1.1809
575 T B -1.4704
576 K B -2.5635
577 N B -2.6929
578 Q B -2.5988
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B -0.6483
587 G B -0.9327
588 F B 0.0000
589 Y B -1.2187
590 P B 0.0000
591 S B -0.0500
592 D B -0.9665
593 I B 0.0000
594 A B -0.5277
595 V B 0.0000
596 E B -1.3998
597 W B 0.0000
598 E B -2.1587
599 S B 0.0000
600 N B -2.2181
601 G B -1.8452
602 Q B -2.3242
603 P B -2.2180
604 E B -2.6377
605 N B -2.2877
606 N B -1.7388
607 Y B -1.1735
608 K B -0.7937
609 T B -0.4529
610 T B 0.0000
611 P B 0.0074
612 P B 0.2535
613 V B 0.7186
614 L B 0.8328
615 D B -0.4068
616 S B -1.3003
617 D B -1.9125
618 G B -0.7456
619 S B 0.0000
620 F B 0.2400
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.9041
628 V B -1.4423
629 D B -2.7678
630 K B -2.8268
631 S B -2.5538
632 R B -3.3406
633 W B -2.4150
634 Q B -2.7894
635 Q B -2.7661
636 G B -1.4949
637 N B -1.4266
638 V B -0.4529
639 F B 0.0000
640 S B -1.2748
641 C B 0.0000
642 S B -0.8131
643 V B 0.0000
644 M B -0.4276
645 H B 0.0000
646 E B -1.0355
647 A B -1.7109
648 L B 0.0000
649 H B -1.6246
650 N B -1.4992
651 H B -0.8818
652 Y B 0.0698
653 T B -0.7745
654 Q B -1.3178
655 K B -1.2207
656 S B -0.4760
657 L B 0.0000
658 S B 0.2827
659 L B 1.2784
660 S B 0.1867
661 P B -0.0878
662 G B -0.7424
663 D C -1.1459
664 I C 0.0582
665 Q C 0.0000
666 M C -0.4366
667 T C 0.0000
668 Q C -0.9945
669 S C -0.6120
670 P C -0.8654
671 S C -0.9433
672 S C -0.8339
673 L C -0.4599
674 S C -0.8295
675 A C 0.0000
676 S C -0.7272
677 V C 0.3276
678 G C -0.7598
679 D C -1.7955
680 R C -2.5035
681 V C 0.0000
682 T C -0.6297
683 I C 0.0000
684 T C -0.8240
685 C C 0.0000
686 R C -2.3491
687 A C 0.0000
688 S C -1.4396
689 Q C -2.2308
690 D C -2.7310
691 I C 0.0000
692 S C -0.4571
693 S C 0.0582
694 Y C 1.0129
695 L C 0.0000
696 N C 0.0000
697 W C 0.0000
698 Y C 0.0000
699 Q C 0.0000
700 Q C -1.5943
701 K C -2.3308
702 P C -1.8189
703 G C -1.9809
704 K C -2.7306
705 A C -1.7860
706 P C 0.0000
707 K C -1.5070
708 L C 0.0000
709 L C 0.0000
710 I C 0.0000
711 Y C 0.3499
712 Y C 0.7570
713 T C 0.0335
714 S C -0.5517
715 R C -1.4009
716 L C -0.3756
717 H C -0.4985
718 S C -0.5384
719 G C -0.4389
720 V C -0.4419
721 P C -0.8540
722 S C -0.9257
723 R C -1.8709
724 F C 0.0000
725 S C -0.7763
726 G C -0.3211
727 S C -0.5863
728 G C -0.7631
729 S C -1.0125
730 G C -1.7159
731 T C -2.0940
732 D C -2.2398
733 F C 0.0000
734 T C -0.7180
735 F C 0.0000
736 T C -0.7470
737 I C 0.0000
738 S C -1.6927
739 S C -1.3348
740 L C 0.0000
741 Q C -0.9071
742 P C -1.5287
743 E C -2.2277
744 D C 0.0000
745 I C -1.2859
746 A C 0.0000
747 T C -1.0585
748 Y C 0.0000
749 Y C 0.0000
750 C C 0.0000
751 I C 0.0000
752 I C 0.0000
753 L C 0.7883
754 M C 0.5285
755 L C 1.2934
756 A C 0.5041
757 G C 0.0555
758 G C 0.2867
759 L C 0.3323
760 F C 0.0000
761 G C 0.0000
762 Q C -1.6027
763 G C -1.3445
764 T C 0.0000
765 K C -1.6324
766 V C 0.0000
767 E C -1.2822
768 I C 0.0000
769 K C -1.1677
770 R C -0.9183
771 T C 0.1074
772 V C 1.1205
773 A C 0.4695
774 A C 0.1031
775 P C -0.2820
776 S C -0.3212
777 V C 0.0000
778 F C 0.0794
779 I C 0.0000
780 F C 0.0000
781 P C 0.0000
782 P C 0.0000
783 S C 0.0000
784 D C -3.0778
785 E C -3.0823
786 Q C 0.0000
787 L C 0.0000
788 K C -2.9355
789 S C -1.8208
790 G C -1.3489
791 T C -0.9384
792 A C 0.0000
793 S C 0.0000
794 V C 0.0000
795 V C 0.0000
796 C C 0.0000
797 L C 0.0000
798 L C 0.0000
799 N C 0.0000
800 N C -0.9318
801 F C 0.0000
802 Y C 0.0000
803 P C -1.7338
804 R C -3.2312
805 E C -3.3276
806 A C -2.5330
807 K C -2.7372
808 V C -1.3863
809 Q C -1.3122
810 W C 0.0000
811 K C -0.7951
812 V C -0.8930
813 D C -1.6088
814 N C -1.3669
815 A C -0.5233
816 L C -0.0116
817 Q C -1.2307
818 S C -0.9403
819 G C -1.2973
820 N C -2.0106
821 S C -1.5894
822 Q C -1.3302
823 E C -2.0102
824 S C 0.0000
825 V C -0.8228
826 T C -1.2020
827 E C -2.4976
828 Q C -2.5674
829 D C -2.8765
830 S C -2.6389
831 K C -2.8606
832 D C -2.8489
833 S C -2.5836
834 T C 0.0000
835 Y C 0.0000
836 S C 0.0000
837 L C -0.6704
838 S C 0.0000
839 S C 0.0000
840 T C -0.6914
841 L C 0.0000
842 T C -0.5686
843 L C -0.6048
844 S C -1.2322
845 K C -2.2360
846 A C -2.1138
847 D C -2.2998
848 Y C 0.0000
849 E C -3.7681
850 K C -3.5518
851 H C -3.1130
852 K C -3.3294
853 V C -1.6300
854 Y C 0.0000
855 A C -1.1126
856 C C 0.0000
857 E C -1.1995
858 V C 0.0000
859 T C -1.1962
860 H C 0.0000
861 Q C -1.7847
862 G C -0.3906
863 L C -0.1007
864 S C -0.4166
865 S C -0.3435
866 P C -0.4895
867 V C -0.1065
868 T C -0.7060
869 K C -1.1698
870 S C -0.9785
871 F C 0.0000
872 N C -2.4735
873 R C -2.6644
874 G C -2.2442
875 E C -2.1327
876 C C -1.2422
877 Q D -0.6183
878 V D 0.8797
879 Q D -0.9565
880 L D 0.0000
881 Q D -2.0015
882 E D -1.2583
883 S D -0.9247
884 G D -0.3678
885 P D 0.0000
886 G D 0.0714
887 L D 0.0466
888 V D 0.0000
889 R D -1.2328
890 P D -0.9375
891 S D -1.0016
892 Q D -1.0969
893 T D -0.9478
894 L D -0.5995
895 S D -0.6574
896 L D 0.0000
897 T D -0.8909
898 C D 0.0000
899 T D -1.2319
900 V D -0.7225
901 S D -0.4483
902 G D 0.4503
903 Y D 1.1823
904 S D 0.2673
905 I D 0.0000
906 T D -0.9944
907 S D -0.8164
908 D D -1.8694
909 H D 0.0000
910 A D 0.0000
911 W D 0.0000
912 S D 0.0000
913 W D 0.0000
914 V D 0.0000
915 R D -0.5315
916 Q D -0.9136
917 P D 0.0000
918 P D -1.1175
919 G D -1.5447
920 R D -2.5887
921 G D -1.7565
922 L D 0.0000
923 E D -1.1169
924 W D 0.0000
925 I D 0.0000
926 G D 0.0000
927 Y D 0.0000
928 I D 0.0000
929 S D 0.0000
930 Y D 0.0712
931 S D -0.0145
932 G D 0.5988
933 I D 2.0102
934 T D 1.1536
935 T D 0.3260
936 Y D -0.3961
937 N D -0.8032
938 P D -1.1249
939 S D -1.0594
940 L D 0.0000
941 K D -2.2064
942 S D -1.5022
943 R D -1.8612
944 V D 0.0000
945 T D -0.9236
946 M D 0.0000
947 L D -0.5446
948 R D -1.8814
949 D D -2.7852
950 T D -1.8177
951 S D -1.8213
952 K D -2.7233
953 N D -1.8779
954 Q D -1.9048
955 F D 0.0000
956 S D 0.0000
957 L D 0.0000
958 R D -1.3788
959 L D 0.0000
960 S D -1.0778
961 S D -0.9102
962 V D 0.0000
963 T D -0.5029
964 A D -0.2622
965 A D -0.0689
966 D D -0.2719
967 T D 0.1571
968 A D 0.0000
969 V D 0.5688
970 Y D 0.0000
971 Y D 0.0000
972 C D 0.0000
973 A D 0.0000
974 R D -0.3905
975 S D 0.0000
976 L D 0.0115
977 A D -0.1739
978 R D -1.8034
979 T D 0.0000
980 T D -0.9451
981 A D 0.0000
982 M D 0.0000
983 D D 0.0000
984 Y D -0.0645
985 W D 0.0000
986 G D 0.0000
987 Q D -1.9601
988 G D 0.0000
989 S D 0.1136
990 L D 1.2286
991 V D 0.0000
992 T D 0.1417
993 V D 0.0000
994 S D -0.4822
995 S D -0.6385
996 A D -0.5971
997 S D -0.8303
998 T D -1.0335
999 K D -1.8139
1000 G D -1.5093
1001 P D -0.7877
1002 S D -0.4663
1003 V D 0.0000
1004 F D 0.0000
1005 P D -1.3771
1006 L D 0.0000
1007 A D 0.0000
1008 P D 0.0000
1009 S D -1.1179
1010 S D -1.2167
1011 K D -1.9957
1012 S D -1.2300
1013 T D -0.9526
1014 S D -0.8836
1015 G D -0.7763
1016 G D -0.7084
1017 T D -0.5151
1018 A D 0.0000
1019 A D 0.0000
1020 L D 0.0000
1021 G D 0.0000
1022 C D 0.0000
1023 L D 0.0000
1024 V D 0.0000
1025 K D -0.4039
1026 D D -0.7102
1027 Y D 0.0000
1028 F D 0.0000
1029 P D 0.0000
1030 E D -0.6697
1031 P D -0.6227
1032 V D -0.4648
1033 T D -0.4050
1034 V D -0.3116
1035 S D -0.3431
1036 W D 0.0000
1037 N D -0.8114
1038 S D -0.6846
1039 G D -0.3987
1040 A D -0.1840
1041 L D 0.0351
1042 T D -0.0921
1043 S D -0.1003
1044 G D -0.1619
1045 V D 0.3442
1046 H D -0.1045
1047 T D 0.0873
1048 F D 0.0000
1049 P D -0.2122
1050 A D 0.1688
1051 V D 0.5870
1052 L D 1.1453
1053 Q D -0.4686
1054 S D -0.3418
1055 S D -0.4118
1056 G D 0.0000
1057 L D -0.0342
1058 Y D 0.1559
1059 S D 0.0000
1060 L D 0.0874
1061 S D 0.0000
1062 S D 0.0000
1063 V D 0.0000
1064 V D 0.0000
1065 T D -0.0588
1066 V D 0.0000
1067 P D -0.5654
1068 S D -0.5889
1069 S D -0.6592
1070 S D -0.7661
1071 L D -0.9352
1072 G D -1.2019
1073 T D -0.9235
1074 Q D -1.3523
1075 T D -1.3323
1076 Y D 0.0000
1077 I D -1.4284
1078 C D 0.0000
1079 N D -1.5620
1080 V D 0.0000
1081 N D -1.6013
1082 H D 0.0000
1083 K D -1.8212
1084 P D -1.3401
1085 S D -1.6447
1086 N D -2.1282
1087 T D -1.8742
1088 K D -2.4284
1089 V D -1.6838
1090 D D -2.5411
1091 K D -2.1024
1092 K D -2.6441
1093 V D 0.0000
1094 E D -2.5826
1095 P D -1.5239
1096 K D -1.3668
1097 S D -1.3862
1098 C D -1.0224
1099 D D -2.1310
1100 K D -2.2865
1101 T D 0.0000
1102 H D -1.6783
1103 T D -1.4215
1104 C D 0.0000
1105 P D -1.0274
1106 P D -0.8864
1107 C D 0.0000
1108 P D -0.9497
1109 A D 0.0000
1110 P D -1.0125
1111 E D -1.5039
1112 L D -0.1952
1113 L D 0.9000
1114 G D -0.2138
1115 G D -0.1352
1116 P D -0.0350
1117 S D 0.2856
1118 V D 0.0000
1119 F D 2.2289
1120 L D 1.5957
1121 F D 2.0893
1122 P D 0.4781
1123 P D 0.0000
1124 K D -1.9328
1125 P D -1.2998
1126 K D -0.9895
1127 D D -1.1891
1128 T D 0.0000
1129 L D 0.0000
1130 M D 0.6447
1131 I D 1.6610
1132 S D 0.1061
1133 R D -0.9723
1134 T D -0.5421
1135 P D 0.0000
1136 E D -0.9589
1137 V D 0.0000
1138 T D 1.0210
1139 C D 0.0000
1140 V D 1.0554
1141 V D 0.0000
1142 V D 0.5663
1143 D D -0.1238
1144 V D 0.0000
1145 S D -1.6320
1146 H D -2.2428
1147 E D -2.6966
1148 D D 0.0000
1149 P D -1.9134
1150 E D -1.9734
1151 V D 0.0000
1152 K D -2.2689
1153 F D -1.7875
1154 N D -1.4866
1155 W D 0.0000
1156 Y D -1.2472
1157 V D -0.9220
1158 D D -2.0791
1159 G D -0.7325
1160 V D 0.7129
1161 E D -0.6317
1162 V D 0.1541
1163 H D -1.2317
1164 N D -1.1981
1165 A D -1.1041
1166 K D -2.1304
1167 T D -1.4523
1168 K D -2.0430
1169 P D -1.9329
1170 R D -2.2290
1171 E D -2.3163
1172 E D -2.7855
1173 Q D -1.7888
1174 Y D -0.7163
1175 N D -0.8682
1176 S D -0.6894
1177 T D -0.9249
1178 Y D 0.0000
1179 R D -1.4490
1180 V D 0.0000
1181 V D -0.5599
1182 S D 0.0000
1183 V D 0.0212
1184 L D 0.0000
1185 T D -0.3276
1186 V D 0.4133
1187 L D 1.0522
1188 H D -0.0530
1189 Q D -1.2553
1190 D D -1.1935
1191 W D 0.0000
1192 L D -1.0992
1193 N D -2.1275
1194 G D -2.0159
1195 K D -2.4167
1196 E D -2.4036
1197 Y D 0.0000
1198 K D -2.0296
1199 C D 0.0000
1200 K D -1.7998
1201 V D 0.0000
1202 S D -1.3364
1203 N D -1.6899
1204 K D -2.0505
1205 A D -1.2557
1206 L D -0.5915
1207 P D -0.5015
1208 A D -0.3521
1209 P D -0.4924
1210 I D -0.5999
1211 E D -1.6294
1212 K D -1.7296
1213 T D -1.3464
1214 I D -0.1764
1215 S D -1.7689
1216 K D -1.6608
1217 A D -1.4231
1218 K D -2.3902
1219 G D -2.1603
1220 Q D -2.2401
1221 P D -2.3708
1222 R D -3.0632
1223 E D -2.8059
1224 P D 0.0000
1225 Q D -1.2229
1226 V D 0.0000
1227 Y D 0.0000
1228 T D -0.7134
1229 L D 0.0000
1230 P D -0.3884
1231 P D -0.8456
1232 S D -1.3976
1233 R D -2.5523
1234 D D -2.7366
1235 E D 0.0000
1236 L D -1.2366
1237 T D -1.5168
1238 K D -2.7204
1239 N D -2.8452
1240 Q D -2.7357
1241 V D 0.0000
1242 S D 0.0000
1243 L D 0.0000
1244 T D 0.0000
1245 C D 0.0000
1246 L D 0.0000
1247 V D 0.0000
1248 K D -0.6504
1249 G D -1.1895
1250 F D 0.0000
1251 Y D -1.4596
1252 P D 0.0000
1253 S D -0.0380
1254 D D -0.9761
1255 I D 0.0000
1256 A D 0.0000
1257 V D 0.0000
1258 E D -0.9012
1259 W D 0.0000
1260 E D -1.6271
1261 S D 0.0000
1262 N D -2.0073
1263 G D -1.8064
1264 Q D -2.1508
1265 P D -1.8234
1266 E D -1.9943
1267 N D -1.9943
1268 N D -1.7065
1269 Y D -1.0424
1270 K D -0.7588
1271 T D -0.3961
1272 T D 0.0000
1273 P D 0.0393
1274 P D 0.2987
1275 V D 0.8312
1276 L D 0.9954
1277 D D -0.4125
1278 S D -1.3200
1279 D D -1.9955
1280 G D -0.8962
1281 S D -0.7969
1282 F D -0.0300
1283 F D 0.0000
1284 L D 0.0000
1285 Y D 0.0000
1286 S D 0.0000
1287 K D 0.0000
1288 L D 0.0000
1289 T D -1.0085
1290 V D 0.0000
1291 D D -2.6109
1292 K D -2.2663
1293 S D -1.9502
1294 R D -2.0887
1295 W D -1.7871
1296 Q D -2.3488
1297 Q D -2.2924
1298 G D -1.2786
1299 N D -1.1531
1300 V D -0.2035
1301 F D 0.0000
1302 S D -0.9460
1303 C D 0.0000
1304 S D 0.0000
1305 V D 0.0000
1306 M D 0.0000
1307 H D 0.0000
1308 E D -1.2752
1309 A D -1.9748
1310 L D 0.0000
1311 H D -1.7701
1312 N D -1.6973
1313 H D -1.1555
1314 Y D -0.4671
1315 T D -0.9582
1316 Q D -1.1930
1317 K D -1.0997
1318 S D -0.1403
1319 L D 0.3607
1320 S D 0.0000
1321 L D 1.3625
1322 S D 0.3781
1323 P D -0.4963
1324 G D -0.7352

 

Laboratory of Theory of Biopolymers 2015