Project name: 3mxc_full_Valen

Status: done

submitted: 2018-10-09 16:03:27, status changed: 2018-10-09 16:08:52
Settings
Chain sequence(s) A: MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
L: GENPTY
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4155
Maximal score value
1.9616
Average score
-1.1505
Total score value
-119.6542

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
55 M A 0.1093
56 K A -1.4548
57 P A -0.8843
58 H A -0.6433
59 P A -0.4793
60 W A 0.0000
61 F A 1.7223
62 F A 1.0047
63 G A -0.1687
64 K A -2.2027
65 I A 0.0000
66 P A -2.6740
67 R A -3.3829
68 A A -2.2829
69 K A -2.9592
70 A A 0.0000
71 E A -2.9824
72 E A -3.4155
73 M A -2.0099
74 L A 0.0000
75 S A -2.9894
76 K A -3.1274
77 Q A -2.7760
78 R A -3.2176
79 H A -3.0669
80 D A -2.0741
81 G A 0.0000
82 A A 0.0000
83 F A 0.0000
84 L A 0.0000
85 I A 0.0000
86 R A 0.0000
87 E A -1.8382
88 S A -2.3333
89 E A -2.9581
90 S A -1.5835
91 A A -1.1838
92 P A -1.4772
93 G A -1.2341
94 D A -1.5062
95 F A -1.0857
96 S A 0.0000
97 L A 0.0000
98 S A 0.0000
99 V A 0.0000
100 K A -1.8907
101 F A -1.4103
102 G A -1.7875
103 N A -2.4690
104 D A -2.7828
105 V A 0.0000
106 Q A -1.2456
107 H A -1.3095
108 F A 0.0000
109 K A -0.8421
110 V A 0.0000
111 L A -0.8740
112 R A -2.5356
113 D A -1.7799
114 G A -1.1739
115 A A -1.1092
116 G A -1.5559
117 K A -2.0954
118 Y A -1.4511
119 F A -0.4459
120 L A 0.0000
121 W A 0.8574
122 V A 1.9616
123 V A 1.0417
124 K A -1.1740
125 F A 0.0000
126 N A -2.3193
127 S A -1.5223
128 L A -0.8221
129 N A -1.6637
130 E A -2.6462
131 L A 0.0000
132 V A 0.0000
133 D A -2.4547
134 Y A -0.9038
135 H A 0.0000
136 R A -1.3696
137 S A -0.6558
138 T A -0.3884
139 S A -0.8658
140 V A 0.0000
141 S A -1.9438
142 R A -2.9979
143 N A -2.7905
144 Q A -1.9715
145 Q A -1.8394
146 I A 0.0000
147 F A -0.5576
148 L A 0.0000
149 R A -2.9510
150 D A -2.6212
151 I A -2.2773
152 E A -2.8575
681 G L -0.9140
683 E L -2.2343
684 N L 0.0000
685 P L -0.3258
686 T L 0.2153
687 Y L 1.2508

 

Laboratory of Theory of Biopolymers 2015