Project name: SATYABRATA MAJUMDER

Status: running

submitted: 2018-06-08 16:16:30, status changed: 2018-06-10 06:26:01
Settings
Chain sequence(s) A: MEQAPEDQGPQREPYNDWTLELLEELKNEAVRHFPRIWLHSLGQHIYETYGDTWTGVEALIRILQQLLFIHFRIGCRHSRIGIIQQRRTRNGASKS
Distance of aggregation 10 Å
Dynamic mode Yes

 

Laboratory of Theory of Biopolymers 2015