Project name: 4gvd_modified_chains-AD.pdb_stat_DIBS

Status: done

submitted: 2018-04-18 14:33:59, status changed: 2018-04-20 13:27:30
Settings
Chain sequence(s) A: GAMGKVTHSIHIEKADTYGFSLSSVEEIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPE
D: TKQEEFYA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4923
Maximal score value
0.8803
Average score
-1.0773
Total score value
-102.34

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
837 G A -0.5048
838 A A 0.0341
839 M A 0.6291
840 G A -0.3273
841 K A -0.7530
842 V A 0.8803
843 T A 0.2309
844 H A -0.2141
845 S A -0.7901
846 I A 0.0000
847 H A -1.6159
848 I A 0.0000
849 E A -3.0579
850 K A -2.8589
855 A A -1.0372
856 D A -2.3346
857 T A -1.2196
858 Y A 0.0000
859 G A -0.8329
860 F A 0.0000
861 S A 0.0000
862 L A 0.0000
863 S A 0.0000
864 S A 0.0000
865 V A 0.0000
866 E A -2.7734
867 E A -2.3443
870 I A 0.2439
871 R A -1.6005
872 R A -1.4454
873 L A 0.0000
874 Y A -0.3533
875 V A 0.0000
876 N A -0.9212
877 S A -0.9375
878 V A -1.4199
879 K A -2.6993
880 E A -2.8532
881 T A -1.7228
882 G A -1.8545
883 L A -1.8795
884 A A 0.0000
885 S A -2.2682
886 K A -2.7922
887 K A -2.4880
888 G A -1.5728
889 L A 0.0000
890 K A -1.0867
891 A A -0.6193
892 G A -0.4003
893 D A 0.0000
894 E A 0.0000
895 I A 0.0000
896 L A -0.7519
897 E A -1.6499
898 I A 0.0000
899 N A -1.5924
900 N A -2.1894
901 R A -2.3737
902 A A -1.6530
903 A A -1.8081
904 D A -2.0949
905 A A -1.4632
906 L A 0.0000
907 N A -2.0163
908 S A -1.5854
909 S A -1.6232
910 M A -1.4749
911 L A 0.0000
912 K A -2.8667
913 D A -2.8742
914 F A -1.5576
915 L A 0.0000
916 S A -1.6295
917 Q A -2.0901
918 P A -1.9375
919 S A -1.8145
920 L A 0.0000
921 G A -1.2939
922 L A 0.0000
923 L A -0.6295
924 V A 0.0000
925 R A -0.0576
926 T A -0.0743
927 Y A 0.0809
928 P A -0.7373
929 E A -1.8561
1 T D -2.1741
2 K D -3.4923
3 Q D -3.1211
4 E D -2.7047
5 E D -2.4922
6 F D 0.0000
7 Y D 0.8053
8 A D 0.0136

 

Laboratory of Theory of Biopolymers 2015