Project name: testnita

Status: done

submitted: 2019-02-12 12:14:00, status changed: 2019-02-12 12:20:59
Settings
Chain sequence(s) I: DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC
E: CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.1987
Maximal score value
2.1912
Average score
-0.2406
Total score value
-72.4076

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C E 0.7316
2 G E 0.0000
3 V E 1.7679
4 P E 0.3698
5 A E 0.1461
6 I E 0.2723
7 Q E -1.1080
8 P E 0.0772
9 V E 1.8864
10 L E 0.9468
11 S E -0.0874
12 G E -0.2789
13 L E 1.0782
14 S E 0.0000
15 R E -0.1734
16 I E 2.1912
17 V E 2.0975
18 N E 0.1128
19 G E -0.1280
20 E E -0.5400
21 E E -1.8806
22 A E 0.0000
23 V E 0.5681
24 P E -0.0973
25 G E -0.1163
26 S E 0.0000
27 W E 0.0000
28 P E 0.0000
29 W E 0.0000
30 Q E 0.0000
31 V E 0.0000
32 S E 0.0000
33 L E 0.0000
34 Q E 0.0000
35 D E -0.9305
36 K E -1.8220
37 T E -0.5373
38 G E -0.3134
39 F E 0.7962
40 H E 0.0000
41 F E 0.1881
42 C E 0.0000
43 G E 0.0000
44 G E 0.0000
45 S E 0.0000
46 L E 0.0000
47 I E 0.1077
48 N E -0.7098
49 E E -1.3677
50 N E -0.7283
51 W E 0.0000
52 V E 0.0000
53 V E 0.0000
54 T E 0.0000
55 A E 0.0000
56 A E 0.0000
57 H E 0.0000
58 C E 0.0000
59 G E -0.4663
60 V E 0.0000
61 T E -0.0549
62 T E -0.0865
63 S E -0.1410
64 D E -0.2536
65 V E 0.0000
66 V E 0.0000
67 V E 0.0000
68 A E 0.0000
69 G E -0.0618
70 E E -0.2574
71 F E 0.1209
72 D E -0.4333
73 Q E -0.6430
74 G E -0.7225
75 S E -0.2040
76 S E -0.2670
77 S E -0.3867
78 E E -1.0840
79 K E -1.7244
80 I E 0.2078
81 Q E -0.4379
82 K E -1.7433
83 L E 0.0000
84 K E -1.7000
85 I E 0.0000
86 A E -0.1928
87 K E -1.1840
88 V E 0.1127
89 F E 0.1980
90 K E -0.9850
91 N E 0.0000
92 S E -0.5262
93 K E -1.7023
94 Y E -0.2593
95 N E -0.7243
96 S E -0.0601
97 L E 1.5020
98 T E 0.2561
99 I E 0.0000
100 N E 0.0000
101 N E -0.1684
102 D E 0.0000
103 I E 0.0000
104 T E 0.0000
105 L E 0.0000
106 L E 0.0000
107 K E -0.6546
108 L E 0.0000
109 S E -0.2248
110 T E -0.0940
111 A E -0.0181
112 A E 0.0000
113 S E 0.0011
114 F E 1.1029
115 S E -0.1624
116 Q E -1.2320
117 T E -0.2570
118 V E 0.0000
119 S E -0.0361
120 A E 0.0206
121 V E 0.0000
122 C E 0.0000
123 L E 0.4341
124 P E 0.0000
125 S E -0.1793
126 A E -0.0160
127 S E -0.2638
128 D E -0.7147
129 D E -1.8005
130 F E -0.0305
131 A E 0.1208
132 A E 0.0082
133 G E -0.4594
134 T E -0.1218
135 T E -0.0816
136 C E 0.0000
137 V E 0.0000
138 T E 0.0000
139 T E 0.0000
140 G E 0.0000
141 W E 0.0000
142 G E 0.0000
143 L E 0.0000
144 T E -0.3598
145 R E -1.8235
146 Y E -0.2055
147 T E -0.0946
148 N E -0.4429
149 A E -0.3066
150 N E -1.2746
151 T E -0.2598
152 P E -0.3605
153 D E -2.0924
154 R E -1.5483
155 L E 0.0000
156 Q E -0.4479
157 Q E 0.0000
158 A E 0.0000
159 S E 0.0000
160 L E 0.0000
161 P E -0.0521
162 L E 0.0000
163 L E 0.2327
164 S E -0.0814
165 N E -0.3849
166 T E -0.3761
167 N E -1.2862
168 C E 0.0000
169 K E -1.4280
170 K E -1.7985
171 Y E 0.2642
172 W E 0.0000
173 G E -0.3517
174 T E -0.3243
175 K E -1.2827
176 I E 0.0000
177 K E -1.3916
178 D E -1.9866
179 A E 0.0000
180 M E 0.0000
181 I E 0.0000
182 C E 0.0000
183 A E 0.0000
184 G E 0.0000
185 A E -0.0370
186 S E -0.0883
187 G E -0.0900
188 V E 0.0000
189 S E -0.0353
190 S E -0.0342
191 C E 0.0000
192 M E 0.0000
193 G E -0.0860
194 D E -0.1979
195 S E 0.0000
196 G E 0.0000
197 G E 0.0000
198 P E 0.0000
199 L E 0.0000
200 V E 0.0000
201 C E 0.0000
202 K E -1.8994
203 K E -1.6119
204 N E -1.5541
205 G E -0.6966
206 A E -0.0795
207 W E 0.0000
208 T E 0.0000
209 L E 0.0000
210 V E 0.0000
211 G E 0.0000
212 I E 0.0000
213 V E 0.0000
214 S E 0.0000
215 W E 0.0000
216 G E -0.0643
217 S E -0.0389
218 S E 0.0000
219 T E -0.0294
220 C E 0.0000
221 S E -0.0505
222 T E -0.0738
223 S E -0.2157
224 T E -0.0473
225 P E 0.0000
226 G E -0.0741
227 V E 0.0000
228 Y E 0.0000
229 A E 0.0000
230 R E -0.3304
231 V E 0.0000
232 T E 0.0076
233 A E 0.0354
234 L E 0.0000
235 V E 0.0000
236 N E -1.2312
237 W E -0.1137
238 V E 0.0000
239 Q E -1.4192
240 Q E -1.3959
241 T E 0.0000
242 L E 0.2728
243 A E 0.1184
244 A E -0.1628
245 N E -1.2623
1 D I -1.8283
2 S I -0.2501
3 L I 1.4864
4 G I -0.1462
5 R I -2.1987
6 E I -2.0745
7 A I -0.6371
8 K I -1.6642
9 C I -0.0323
10 Y I 0.3454
11 N I -1.5152
12 E I -1.9122
13 L I 0.2605
14 N I -1.1861
15 G I -0.5417
16 C I 0.0872
17 T I 0.2507
18 Y I 1.2577
19 E I -0.0394
20 Y I 0.0000
21 R I -1.8441
22 P I 0.0000
23 V I 0.0000
24 C I 0.0000
25 G I 0.0000
26 T I -0.2557
27 D I -1.0587
28 G I -0.3357
29 D I -0.3250
30 T I -0.0634
31 Y I 0.0000
32 P I 0.0000
33 N I 0.0000
34 E I -0.4770
35 C I 0.0000
36 V I 0.0000
37 L I 0.0000
38 C I 0.1359
39 F I 0.2166
40 E I 0.0000
41 N I -0.4983
42 R I -2.1969
43 K I -1.7979
44 R I -0.9239
45 Q I -1.4718
46 T I -0.3052
47 S I -0.1545
48 I I 0.3640
49 L I 0.2257
50 I I 0.0000
51 Q I -1.4112
52 K I -1.3885
53 S I -0.4462
54 G I -0.1613
55 P I 0.0004
56 C I 0.2647

 

Laboratory of Theory of Biopolymers 2015