Project name: Model2aggre

Status: done

submitted: 2017-03-14 16:18:58, status changed: 2017-03-14 16:35:19
Settings
Chain sequence(s) C: TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.3793
Maximal score value
1.9426
Average score
-0.3611
Total score value
-83.0533

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 T C -0.0521
8 P C -0.0847
9 I C 0.3397
10 F C 0.7495
11 A C 0.1050
12 P C -0.2524
13 G C 0.0000
14 E C -2.0450
15 N C -1.5707
16 C C -0.1313
17 S C -0.1033
18 P C -0.2642
19 A C 0.0096
20 W C 0.0805
21 G C -0.1763
22 A C 0.0089
23 A C 0.0000
24 P C -0.0804
25 A C -0.0123
26 A C 0.1788
27 Y C 0.3035
28 D C -1.6609
29 A C -0.2687
30 A C -0.1675
31 D C -1.2537
32 T C -0.2751
33 H C -0.1601
34 L C 0.0000
35 R C -1.8489
36 I C 0.0000
37 L C 1.4326
38 G C -0.2200
39 K C -0.3302
40 P C -0.2531
41 V C 0.3294
42 M C 0.0000
43 E C -0.7580
44 R C -2.1138
45 W C 0.0000
46 E C -2.0259
47 T C -0.3937
48 P C -0.0900
49 Y C 0.0000
50 M C 0.0000
51 H C -0.8502
52 A C -0.1216
53 L C 0.0000
54 A C 0.0000
55 A C 0.0505
56 A C 0.0000
57 A C 0.0000
58 S C -0.0463
59 S C -0.3499
60 K C -1.7884
61 G C -0.7561
62 G C 0.0000
63 R C -1.4811
64 V C 0.0000
65 L C 0.0000
66 E C 0.0000
67 V C 0.0000
68 G C 0.0000
69 F C 0.0000
70 G C -0.1013
71 M C 0.0000
72 A C 0.0894
73 I C 0.3945
74 A C 0.0000
75 A C -0.0085
76 S C -0.1384
77 K C -0.4278
78 V C 0.0000
79 Q C -0.5799
80 E C -1.8604
81 A C -0.3548
82 P C -0.2502
83 I C 0.0000
84 D C -1.8909
85 E C -1.0707
86 H C 0.0000
87 W C 0.1668
88 I C 0.0000
89 I C 0.0000
90 E C 0.0000
91 C C 0.1590
92 N C 0.0000
93 D C -1.8667
94 G C -0.8748
95 V C 0.1335
96 F C 0.0252
97 Q C -1.5406
98 R C -1.9943
99 L C -0.5430
100 R C -2.1163
101 D C -1.9006
102 W C 0.6922
103 A C 0.0636
104 P C -0.5824
105 R C -1.9846
106 Q C -1.5288
107 T C -0.4288
108 H C -1.1338
109 K C -1.8175
110 V C -0.0634
111 I C 0.2917
112 P C 0.0766
113 L C 0.0085
114 K C -1.6556
115 G C -0.3406
116 L C 0.1622
117 W C 0.0000
118 E C -2.1365
119 D C -2.1120
120 V C 0.0000
121 A C -0.2533
122 P C -0.2665
123 T C -0.1163
124 L C 0.0000
125 P C -0.4832
126 D C -1.2852
127 G C -0.4742
128 H C -0.5893
129 F C 0.0000
130 D C -0.1875
131 G C 0.0000
132 I C 0.0000
133 L C 0.0000
134 Y C 0.0000
135 D C -0.2408
136 T C 0.0000
137 Y C 0.1680
138 P C 0.0000
139 L C 0.1692
140 S C -0.7268
141 E C -2.1650
142 E C -2.1653
143 T C -0.3422
144 W C 0.0936
145 H C -0.1659
146 T C -0.0920
147 H C -0.3305
148 Q C 0.0000
149 F C 0.1158
150 N C -1.2002
151 F C 0.0000
152 I C 0.0000
153 K C -1.9019
154 N C -0.9527
155 H C -0.9922
156 A C 0.0000
157 F C 1.1172
158 R C -1.6579
159 L C 0.0000
160 L C 0.0000
161 K C -0.6963
162 P C -0.3869
163 G C -0.2037
164 G C 0.0000
165 V C 0.0000
166 L C 0.0000
167 T C 0.0000
168 Y C 0.0000
169 C C 0.0000
170 N C 0.0000
171 L C 0.2012
172 T C 0.0140
173 S C -0.0394
174 W C 0.0000
175 G C 0.0000
176 E C -1.7855
177 L C -0.1288
178 M C -0.1718
179 K C -1.5840
180 S C -0.7873
181 K C -1.5080
182 Y C 0.2600
183 S C -0.4107
184 D C -1.8257
185 I C 0.0000
186 T C 0.3396
187 I C 1.9426
188 M C 0.7316
189 F C 0.0000
190 E C -0.7673
191 E C -1.8827
192 T C -0.3448
193 Q C 0.0000
194 V C 0.4479
195 P C 0.0747
196 A C 0.0000
197 L C 0.0000
198 L C 0.5899
199 E C -1.6718
200 A C -0.2771
201 G C -0.2135
202 F C 0.0000
203 R C -2.1764
204 R C -2.3793
205 E C -1.6526
206 N C -1.3911
207 I C 0.0009
208 R C -0.8307
209 T C -0.4814
210 E C -1.2247
211 V C 1.5161
212 M C 0.4877
213 A C 0.0340
214 L C 0.0000
215 V C 1.7465
216 P C 0.2474
217 P C -0.2598
218 A C 0.0000
219 D C -1.5610
220 C C 0.1303
221 R C -1.5960
222 Y C 0.0982
223 Y C 0.0000
224 A C 0.0358
225 F C 0.0000
226 P C 0.0230
227 Q C -0.4129
228 M C 0.0000
229 I C 0.0000
230 T C 0.0000
231 P C 0.0000
232 L C 0.0000
233 V C 0.0000
234 T C 0.0000
235 K C -0.4168
236 G C -0.5437

 

Laboratory of Theory of Biopolymers 2015