Project name: 97ffe8518c615fa

Chain sequence(s)	A: KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.941
• Maximal score value: 2.4245
• Average score: -1.8817
• Total score value: -79.03

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-2.9164
2	K	A	-2.8839
3	K	A	-2.2866
4	P	A	-0.8289
5	L	A	0.2512
6	D	A	-0.5400
7	G	A	-0.6726
8	E	A	-0.8218
9	Y	A	1.1399
10	F	A	2.4245
11	T	A	1.7040
12	L	A	1.3084
13	Q	A	-0.6059
14	I	A	-1.4155
15	R	A	-2.7352
16	G	A	-3.1079
17	R	A	-3.6613
18	E	A	-3.9410
19	R	A	-3.4824
20	F	A	-2.7996
21	E	A	-3.4323
22	M	A	-1.9286
23	F	A	-1.7139
24	R	A	-3.3071
25	E	A	-3.1532
26	L	A	-0.9504
27	N	A	-2.2807
28	E	A	-3.1817
29	A	A	-1.5304
30	L	A	-0.9666
31	E	A	-2.6357
32	L	A	-1.0792
33	K	A	-2.7378
34	D	A	-3.2723
35	A	A	-2.1619
36	Q	A	-3.1819
37	A	A	-2.8680
38	G	A	-2.7383
39	K	A	-3.7445
40	E	A	-3.1564
41	P	A	-1.8381
42	G	A	-1.3000