Project name: 1JD5_A_Valen

Status: done

submitted: 2018-10-09 14:36:31, status changed: 2018-10-09 14:43:08
Settings
Chain sequence(s) A: GNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEES
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0008
Maximal score value
1.4192
Average score
-0.8727
Total score value
-91.6319

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
214 G A -0.5861
215 N A -0.6682
216 Y A 0.5113
217 F A 1.4192
218 P A 0.1331
219 Q A -0.7426
220 Y A -0.6453
221 P A -0.4288
222 E A -1.5834
223 Y A -0.6364
224 A A -0.0049
225 I A 0.7302
226 E A -1.6748
227 T A -0.8548
228 A A -0.6793
229 R A 0.0000
230 L A -1.6682
231 R A -2.4924
232 T A -1.3946
233 F A 0.0000
234 E A -2.5241
235 A A -1.3063
236 W A 0.0000
237 P A -1.9289
238 R A -3.0771
239 N A -2.6397
240 L A -2.6171
241 K A -3.5608
242 Q A 0.0000
243 K A -2.3808
244 P A -2.2657
245 H A -2.4138
246 Q A -2.0270
247 L A 0.0000
248 A A 0.0000
249 E A -2.3524
250 A A 0.0000
251 G A 0.0000
252 F A 0.0000
253 F A 0.0000
254 Y A 0.0000
255 T A -0.1951
256 G A -0.1473
257 V A 1.1158
258 G A -0.2119
259 D A -0.7864
260 R A -0.8337
261 V A 0.0000
262 R A -0.8433
263 C A 0.0000
264 F A 0.0000
265 S A 0.0000
266 C A -0.4272
267 G A -0.4999
268 G A -0.3550
269 G A -0.4437
270 L A 0.0000
271 M A -0.6772
272 D A -2.2280
273 W A 0.0000
274 N A -3.2847
275 D A -3.8328
276 N A -3.0970
277 D A -2.5984
278 E A -1.8079
279 P A 0.0000
280 W A 0.0000
281 E A -0.7212
282 Q A 0.0000
283 H A 0.0000
284 A A 0.0000
285 L A 0.0000
286 W A -0.0507
287 L A -0.2415
288 S A -1.1519
289 Q A -1.6956
290 C A 0.0000
291 R A -1.4076
292 F A 0.0000
293 V A 0.0000
294 K A -0.5860
295 L A 0.9385
296 M A 0.6947
297 K A -0.1219
298 G A -0.2043
299 Q A -0.5223
300 L A 0.4489
301 Y A -0.1076
302 I A 0.0000
303 D A -1.5025
304 T A -0.7671
305 V A 0.0000
306 A A -1.0316
307 A A -0.8171
308 K A -1.0490
309 P A -0.4543
310 V A 0.5801
311 L A 0.0000
312 A A -1.8193
313 E A -3.1109
314 E A -2.5536
315 K A -2.9318
316 E A -4.0008
317 E A -3.7202
318 S A -2.2119

 

Laboratory of Theory of Biopolymers 2015