Project name: a43478773302dd4

Status: done

submitted: 2018-03-11 09:11:38, status changed: 2018-03-11 09:40:16
Settings
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGYTFTTYGISWVRQAPGQGLEWMGRRIWFGELPNPGAFDIRVTMTRDTSISTAYMELSSLRSEDTAVYYCARVYYYYYYGMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: DIVLTQPPSVSGAPGQRVTISCGYSFASYWIGYQQLPGTAPKLLIYDGIAAAGTQYVLYYYYGMDVVPDRFSGSKSGTSASLAITGLQSEDEADYYCDTDFDYYDSSGYYYYYGMDVGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVQSGAEVKKPGSSVKVSCKASGYTFTTYGISWVRQAPGQGLEWMGRRIWFGELPNPGAFDIRVTMTRDTSISTAYMELSSLRSEDTAVYYCARVYYYYYYGMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: DIVLTQPPSVSGAPGQRVTISCGYSFASYWIGYQQLPGTAPKLLIYDGIAAAGTQYVLYYYYGMDVVPDRFSGSKSGTSASLAITGLQSEDEADYYCDTDFDYYDSSGYYYYYGMDVGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9518
Maximal score value
3.3565
Average score
-0.5803
Total score value
-790.4322

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4939
2 V A -0.9292
3 Q A -1.5391
4 L A 0.0000
5 V A -0.7319
6 Q A -0.6972
7 S A -0.9999
8 G A -0.8620
9 A A -0.5203
10 E A -1.4879
11 V A -0.4219
12 K A -1.8945
13 K A -2.5103
14 P A -2.3287
15 G A -1.7183
16 S A -1.3543
17 S A -1.4318
18 V A 0.0000
19 K A -2.1461
20 V A 0.0000
21 S A -0.8992
22 C A 0.0000
23 K A -1.4804
24 A A 0.0000
25 S A -1.1098
26 G A -1.0424
27 Y A 0.0000
28 T A 0.0623
29 F A 0.0820
30 T A -0.1610
31 T A 0.3198
32 Y A 0.4775
33 G A 0.0000
34 I A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.4734
40 A A 0.0000
41 P A -0.9414
42 G A -0.9797
43 Q A -1.3169
44 G A -0.8574
45 L A 0.0000
46 E A -0.9739
47 W A -0.1951
48 M A 0.0000
49 G A 0.0000
50 R A 0.0000
51 R A -1.8157
52 I A -0.4734
53 W A -0.3034
54 F A 0.0000
55 G A 0.0000
56 E A -1.3655
57 L A 0.4365
58 P A -0.3105
59 N A -1.0345
60 P A 0.0000
61 G A 0.0000
62 A A 0.0000
63 F A -0.1965
64 D A -0.8250
65 I A 0.9995
66 R A -0.0081
67 V A 0.0000
68 T A -0.4580
69 M A -0.6967
70 T A -1.0121
71 R A 0.0000
72 D A -0.5701
73 T A -0.0613
74 S A 0.4586
75 I A 1.1833
76 S A 0.1809
77 T A 0.0000
78 A A 0.0000
79 Y A -0.9973
80 M A 0.0000
81 E A -1.2743
82 L A 0.0000
83 S A -0.8979
84 S A -1.2244
85 L A 0.0000
86 R A -3.1656
87 S A -2.4962
88 E A -2.6117
89 D A 0.0000
90 T A -0.8557
91 A A 0.0000
92 V A 0.3425
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 R A 0.0000
98 V A 0.0000
99 Y A 1.4370
100 Y A 2.4208
101 Y A 2.8434
102 Y A 2.5434
103 Y A 2.1020
104 Y A 1.4125
105 G A 0.0000
106 M A 0.0000
107 D A 0.0000
108 V A -0.1658
109 W A 0.0000
110 G A 0.0000
111 Q A -1.1568
112 G A -0.4819
113 T A 0.0000
114 L A 0.3200
115 V A 0.0000
116 T A 0.0000
117 V A 0.0000
118 S A -1.4694
119 S A -1.0894
120 A A -0.7712
121 S A -0.8388
122 T A -0.8084
123 K A -1.3752
124 G A -1.3527
125 P A -0.6085
126 S A -0.1127
127 V A 0.0000
128 F A -0.2876
129 P A -0.8087
130 L A 0.0000
131 A A 0.0000
132 P A 0.0000
133 S A -1.2243
134 S A -1.1782
135 K A -2.0322
136 S A -1.3685
137 T A -1.1048
138 S A -0.8842
139 G A -0.8701
140 G A -0.9148
141 T A -0.7865
142 A A -0.5720
143 A A 0.0000
144 L A 0.0000
145 G A 0.0000
146 C A 0.0000
147 L A 0.0000
148 V A 0.0000
149 K A 0.0000
150 D A -0.2574
151 Y A 0.0000
152 F A 0.0000
153 P A 0.0000
154 E A -1.1441
155 P A -0.9801
156 V A -0.7620
157 T A -0.5667
158 V A -0.1819
159 S A -0.3945
160 W A 0.0000
161 N A -0.7857
162 S A -0.7142
163 G A -0.5975
164 A A -0.2817
165 L A -0.0283
166 T A -0.2091
167 S A -0.2095
168 G A -0.2575
169 V A 0.0982
170 H A -0.1242
171 T A -0.0167
172 F A 0.0000
173 P A -0.1866
174 A A 0.0620
175 V A 0.6263
176 L A 0.9244
177 Q A 0.3065
178 S A -0.1331
179 S A -0.2155
180 G A -0.0105
181 L A 0.0420
182 Y A 0.3924
183 S A 0.0000
184 L A 0.0000
185 S A 0.0000
186 S A 0.0000
187 V A 0.0000
188 V A 0.0000
189 T A -0.1823
190 V A 0.0000
191 P A -0.5087
192 S A -0.6309
193 S A -0.4995
194 S A -0.5819
195 L A -0.7251
196 G A -0.9542
197 T A -0.7180
198 Q A -1.2052
199 T A -1.0541
200 Y A 0.0000
201 I A -1.2604
202 C A 0.0000
203 N A -1.5057
204 V A 0.0000
205 N A -1.8176
206 H A 0.0000
207 K A -2.8224
208 P A -1.7990
209 S A -1.9798
210 N A -2.6327
211 T A -2.0686
212 K A -2.5959
213 V A -1.5879
214 D A -2.4986
215 K A -2.0220
216 K A -2.2648
217 A A 0.0000
218 E A -2.6246
219 P A -1.5788
220 K A -1.6717
221 S A -1.2858
222 C A -1.1180
223 D A -2.5641
224 K A -2.9764
225 T A -2.0453
226 H A -2.4367
227 T A -1.8311
228 C A -0.6848
229 P A -0.5746
230 P A 0.0532
231 C A 0.3827
232 P A -0.4534
233 A A -1.0476
234 P A -1.3773
235 E A -1.6184
236 L A 0.6351
237 L A 0.4459
238 G A -0.2953
239 G A 0.0000
240 P A 0.0000
241 S A 0.1516
242 V A 0.0000
243 F A 2.1669
244 L A 1.6619
245 F A 1.9172
246 P A 0.1244
247 P A 0.0000
248 K A -2.1847
249 P A -1.3863
250 K A -1.0098
251 D A 0.0000
252 T A 0.0000
253 L A 0.0000
254 M A 0.3476
255 I A 1.3577
256 S A -0.0343
257 R A -1.4978
258 T A -0.9034
259 P A 0.0000
260 E A -1.6245
261 V A 0.0000
262 T A 0.7189
263 C A 0.0000
264 V A 1.0537
265 V A 0.0000
266 V A -0.5929
267 D A -1.2605
268 V A 0.0000
269 S A -2.0039
270 H A -2.4796
271 E A -2.9462
272 D A 0.0000
273 P A -2.4114
274 E A -2.8618
275 V A -1.8759
276 K A -2.1812
277 F A 0.0000
278 N A -1.5978
279 W A 0.0000
280 Y A -1.0629
281 V A -0.8698
282 D A -1.7207
283 G A -0.7977
284 V A 0.4764
285 E A -1.3901
286 V A -0.9025
287 H A -2.0715
288 N A -2.1845
289 A A -1.9686
290 K A -2.4649
291 T A -1.9711
292 K A -2.5502
293 P A -2.3377
294 R A -3.5622
295 E A -3.9518
296 E A -3.4199
297 Q A -1.8607
298 Y A 0.0811
299 N A -1.1520
300 S A -1.2603
301 T A -1.7452
302 Y A 0.0000
303 R A -2.6770
304 V A 0.0000
305 V A 0.0000
306 S A 0.0000
307 V A -0.8098
308 L A 0.0000
309 T A -0.9715
310 V A 0.0000
311 L A -0.0781
312 H A -0.6486
313 Q A -1.5501
314 D A -1.5805
315 W A 0.0000
316 L A -1.1659
317 N A -2.1513
318 G A -2.0953
319 K A -2.2396
320 E A -2.2600
321 Y A 0.0000
322 K A -1.6765
323 C A 0.0000
324 K A -1.8397
325 V A 0.0000
326 S A -1.4722
327 N A 0.0000
328 K A -2.1968
329 A A -1.6369
330 L A -0.6296
331 P A -0.6113
332 A A -0.4916
333 P A -0.8351
334 I A -0.4814
335 E A -1.6740
336 K A -1.1257
337 T A -0.9427
338 I A 0.0000
339 S A -1.1470
340 K A -1.3256
341 A A -1.0784
342 K A -2.2201
343 G A -1.7705
344 Q A -1.8284
345 P A -1.7611
346 R A -1.9218
347 E A -2.4336
348 P A 0.0000
349 Q A -1.0290
350 V A 0.0000
351 Y A 0.0000
352 T A 0.0000
353 L A 0.0000
354 P A -0.3780
355 P A -0.7751
356 S A -1.5819
357 R A -2.8659
358 D A -2.2761
359 E A 0.0000
360 L A -1.5779
361 T A -1.5305
362 K A -2.3275
363 N A -2.7318
364 Q A -2.6849
365 V A 0.0000
366 S A 0.0000
367 L A 0.0000
368 T A 0.0000
369 C A 0.0000
370 L A 0.0000
371 V A 0.0000
372 K A -0.4816
373 G A -0.9787
374 F A 0.0000
375 Y A -0.9299
376 P A 0.0000
377 S A -0.2850
378 D A -1.1876
379 I A 0.0000
380 A A -0.6084
381 V A 0.0000
382 E A -0.9644
383 W A 0.0000
384 E A -1.6428
385 S A 0.0000
386 N A -1.7989
387 G A -1.8802
388 Q A -2.3125
389 P A -2.0011
390 E A -1.9540
391 N A -2.3290
392 N A -2.0687
393 Y A -1.2343
394 K A -1.1250
395 T A -0.3941
396 T A 0.0000
397 P A -0.2000
398 P A -0.0109
399 V A 0.0000
400 L A 0.5036
401 D A -0.7153
402 S A -1.2665
403 D A -1.8553
404 G A -0.8538
405 S A 0.0000
406 F A 0.0734
407 F A 0.0000
408 L A 0.0000
409 Y A 0.0000
410 S A 0.0000
411 K A 0.0000
412 L A 0.0000
413 T A -1.1837
414 V A 0.0000
415 D A -2.7260
416 K A -2.6299
417 S A -2.1729
418 R A -1.9671
419 W A 0.0000
420 Q A -2.2278
421 Q A -2.2325
422 G A -1.3413
423 N A -0.6117
424 V A 0.7384
425 F A 0.0000
426 S A -0.6541
427 C A 0.0000
428 S A 0.0000
429 V A 0.0000
430 M A 0.0000
431 H A 0.0000
432 E A -1.3355
433 A A -1.6363
434 L A -1.5381
435 H A -1.8712
436 N A -1.7916
437 H A -1.3741
438 Y A -0.5612
439 T A -0.7896
440 Q A -1.2234
441 K A -1.0128
442 S A -0.3840
443 L A 0.0000
444 S A 0.1046
445 L A -0.4182
446 S A -0.6186
447 P A -0.9492
448 G A -1.6091
449 K A -2.4145
450 Q B -1.4107
451 V B -0.6753
452 Q B -0.9995
453 L B 0.0000
454 V B 0.2646
455 Q B -0.3351
456 S B -0.5839
457 G B -0.3164
458 A B 0.1391
459 E B -0.3737
460 V B -0.2077
461 K B -1.7877
462 K B -2.5444
463 P B -2.2448
464 G B -1.6237
465 S B -1.3490
466 S B -1.4577
467 V B 0.0000
468 K B -2.0330
469 V B 0.0000
470 S B -0.7045
471 C B 0.0000
472 K B -1.0551
473 A B 0.0000
474 S B -0.8514
475 G B -0.9146
476 Y B -0.3396
477 T B -0.1650
478 F B 0.0000
479 T B -0.6644
480 T B -0.0100
481 Y B 0.0000
482 G B 0.0000
483 I B 0.0000
484 S B 0.0000
485 W B 0.0000
486 V B 0.0000
487 R B 0.0000
488 Q B -0.2187
489 A B -0.5925
490 P B -0.7629
491 G B -0.5560
492 Q B -0.0536
493 G B 0.0000
494 L B 0.0000
495 E B 0.1424
496 W B 0.0000
497 M B 0.0000
498 G B 0.0000
499 R B -1.2432
500 R B -1.6033
501 I B -0.1071
502 W B 0.0000
503 F B 0.0000
504 G B 0.0000
505 E B -1.4740
506 L B -0.0797
507 P B -0.8785
508 N B -1.6558
509 P B -1.0144
510 G B -0.5034
511 A B -0.1504
512 F B -0.2587
513 D B -0.6115
514 I B 0.9913
515 R B 0.0092
516 V B 0.0000
517 T B -0.4783
518 M B 0.0000
519 T B -0.4863
520 R B -0.7086
521 D B -0.3229
522 T B -0.0591
523 S B 0.4710
524 I B 1.3082
525 S B 0.1477
526 T B 0.0000
527 A B 0.0000
528 Y B -0.6935
529 M B 0.0000
530 E B -1.4012
531 L B 0.0000
532 S B -0.8057
533 S B -0.9106
534 L B 0.0000
535 R B -2.9309
536 S B -2.3415
537 E B -2.5246
538 D B 0.0000
539 T B -0.8302
540 A B 0.0000
541 V B 0.4900
542 Y B 0.0000
543 Y B 0.0000
544 C B 0.0000
545 A B 0.0000
546 R B 0.0000
547 V B 0.0000
548 Y B 1.5759
549 Y B 2.6199
550 Y B 2.7725
551 Y B 2.7467
552 Y B 2.0473
553 Y B 1.0807
554 G B 0.0000
555 M B 0.0000
556 D B 0.0000
557 V B 0.0469
558 W B 0.0000
559 G B 0.0000
560 Q B -0.9173
561 G B -0.3004
562 T B 0.0000
563 L B 0.9189
564 V B 0.0000
565 T B -0.5665
566 V B 0.0000
567 S B -1.4494
568 S B -1.2746
569 A B -0.7656
570 S B -0.7269
571 T B -0.7711
572 K B -1.1091
573 G B -1.2017
574 P B 0.0000
575 S B -0.1919
576 V B 0.0000
577 F B -0.6514
578 P B -1.0099
579 L B 0.0000
580 A B -1.1917
581 P B 0.0000
582 S B -0.7421
583 S B 0.0000
584 K B -0.4897
585 S B -0.3874
586 T B -0.1376
587 S B -0.2401
588 G B -0.4136
589 G B -0.7155
590 T B -0.5100
591 A B 0.0000
592 A B 0.0000
593 L B 0.0000
594 G B 0.0000
595 C B 0.0000
596 L B 0.0000
597 V B 0.0000
598 K B 0.0000
599 D B 0.0000
600 Y B 0.0000
601 F B 0.0000
602 P B -0.8782
603 E B -1.3531
604 P B -1.2131
605 V B -0.9378
606 T B -0.7670
607 V B -0.4148
608 S B -0.4824
609 W B 0.0000
610 N B -0.8132
611 S B -0.7144
612 G B -0.5995
613 A B -0.2713
614 L B -0.0321
615 T B -0.2143
616 S B -0.2190
617 G B -0.3140
618 V B 0.0484
619 H B -0.2247
620 T B -0.0308
621 F B 0.0000
622 P B -0.2484
623 A B 0.1119
624 V B 0.8585
625 L B 1.6520
626 Q B 0.5987
627 S B 0.0057
628 S B -0.0874
629 G B 0.1308
630 L B 0.1998
631 Y B 0.5479
632 S B 0.0000
633 L B 0.0000
634 S B 0.0000
635 S B 0.0000
636 V B 0.0000
637 V B 0.0000
638 T B -0.1767
639 V B 0.0000
640 P B -0.4375
641 S B -0.6971
642 S B -0.7668
643 S B -0.8006
644 L B -1.2239
645 G B -1.6162
646 T B -0.9695
647 Q B -1.5138
648 T B -1.3600
649 Y B 0.0000
650 I B -1.4420
651 C B 0.0000
652 N B -1.5013
653 V B 0.0000
654 N B -1.9891
655 H B 0.0000
656 K B -2.7523
657 P B -1.7207
658 S B -1.9639
659 N B -2.4028
660 T B -2.1852
661 K B -2.5908
662 V B -1.3313
663 D B -2.4355
664 K B -2.0932
665 K B -2.6528
666 A B 0.0000
667 E B -2.8998
668 P B -2.2474
669 K B -2.4594
670 S B -1.7398
671 C B -1.2030
672 D B -2.1018
673 K B -2.6707
674 T B -1.7656
675 H B -1.7940
676 T B -0.9236
677 C B -0.2777
678 P B -0.2465
679 P B -0.0074
680 C B 0.2778
681 P B -0.4860
682 A B -0.5545
683 P B -0.5647
684 E B -0.9969
685 L B 1.0740
686 L B 0.7061
687 G B -0.2025
688 G B -0.4749
689 P B 0.0000
690 S B -0.1727
691 V B 0.0000
692 F B 1.1121
693 L B 0.8779
694 F B 1.2083
695 P B -0.0434
696 P B 0.0000
697 K B -2.1036
698 P B -1.3093
699 K B -1.0599
700 D B -1.1007
701 T B 0.0000
702 L B -0.1897
703 M B 0.8049
704 I B 1.7196
705 S B 0.4851
706 R B -0.5420
707 T B -0.3916
708 P B 0.0000
709 E B -0.8655
710 V B 0.0000
711 T B 0.3307
712 C B 0.0000
713 V B 0.0000
714 V B 0.0000
715 V B -1.0318
716 D B -2.1337
717 V B 0.0000
718 S B -1.5446
719 H B -1.7076
720 E B -1.3857
721 D B -1.4709
722 P B -2.1660
723 E B -2.6873
724 V B 0.0000
725 K B -1.9360
726 F B -1.0145
727 N B -1.4055
728 W B 0.0000
729 Y B -1.1474
730 V B -1.0499
731 D B -2.1075
732 G B -0.9630
733 V B 0.4451
734 E B -1.4213
735 V B -0.9197
736 H B -2.0721
737 N B -2.2041
738 A B -1.6815
739 K B -2.3138
740 T B -1.7576
741 K B -2.3546
742 P B -2.3240
743 R B -3.7863
744 E B -3.9192
745 E B -3.5086
746 Q B -2.1924
747 Y B -0.1925
748 N B -1.3442
749 S B -1.3281
750 T B -2.0659
751 Y B 0.0000
752 R B -2.9592
753 V B 0.0000
754 V B 0.0000
755 S B 0.0000
756 V B -0.7335
757 L B 0.0000
758 T B -0.6316
759 V B 0.0000
760 L B 0.1017
761 H B -0.3203
762 Q B -1.5022
763 D B -1.6901
764 W B 0.0000
765 L B -0.8777
766 N B -2.1844
767 G B -2.2120
768 K B -2.5290
769 E B -2.8757
770 Y B 0.0000
771 K B -1.9195
772 C B 0.0000
773 K B -1.4944
774 V B 0.0000
775 S B -1.2189
776 N B 0.0000
777 K B -1.6345
778 A B 0.0000
779 L B 0.0000
780 P B -0.4366
781 A B -0.4579
782 P B -0.7712
783 I B -0.6564
784 E B -1.7927
785 K B -1.4133
786 T B -1.1471
787 I B -0.4124
788 S B -1.2545
789 K B -1.3265
790 A B -1.1463
791 K B -2.3735
792 G B -2.0894
793 Q B -2.3360
794 P B -2.1696
795 R B -2.6368
796 E B -2.7034
797 P B 0.0000
798 Q B -0.9396
799 V B -0.6532
800 Y B 0.0000
801 T B 0.0000
802 L B 0.0000
803 P B -0.3447
804 P B -0.7031
805 S B -1.1176
806 R B -2.0826
807 D B -1.6888
808 E B 0.0000
809 L B -1.4900
810 T B -1.3978
811 K B -2.2948
812 N B -2.8964
813 Q B -2.9981
814 V B 0.0000
815 S B 0.0000
816 L B 0.0000
817 T B 0.0000
818 C B 0.0000
819 L B 0.0000
820 V B 0.0000
821 K B -0.5478
822 G B -1.1091
823 F B 0.0000
824 Y B -1.2740
825 P B 0.0000
826 S B -0.1875
827 D B -0.8424
828 I B -0.4585
829 A B 0.0000
830 V B -0.2317
831 E B -0.8291
832 W B 0.0000
833 E B -1.6444
834 S B 0.0000
835 N B -1.8632
836 G B -1.8756
837 Q B -2.2969
838 P B -1.9122
839 E B -1.8665
840 N B -2.1640
841 N B -1.7516
842 Y B -1.1217
843 K B -1.1608
844 T B -0.4220
845 T B 0.0000
846 P B -0.2565
847 P B 0.0251
848 V B 0.0000
849 L B 0.4872
850 D B -0.7236
851 S B -1.3146
852 D B -1.9162
853 G B -0.9480
854 S B 0.0000
855 F B -0.0409
856 F B 0.0000
857 L B 0.0000
858 Y B 0.0000
859 S B 0.0000
860 K B 0.0000
861 L B 0.0000
862 T B -1.2277
863 V B 0.0000
864 D B -3.1374
865 K B -3.0717
866 S B -2.5713
867 R B -2.3073
868 W B 0.0000
869 Q B -2.4339
870 Q B -2.1529
871 G B -1.1373
872 N B -0.6976
873 V B 0.4691
874 F B 0.0000
875 S B -0.7729
876 C B 0.0000
877 S B 0.0000
878 V B 0.0000
879 M B 0.0000
880 H B 0.0000
881 E B -1.2033
882 A B -1.8072
883 L B 0.0000
884 H B -1.9729
885 N B -1.8843
886 H B -1.4518
887 Y B -0.6762
888 T B -0.9574
889 Q B -1.4258
890 K B -1.1723
891 S B -0.5476
892 L B 0.0000
893 S B -0.1116
894 L B -0.2804
895 S B -0.6390
896 P B -1.0869
897 G B -1.7198
898 K B -2.6204
899 D C -1.1281
900 I C 0.5324
901 V C 1.5295
902 L C 0.0000
903 T C 0.1816
904 Q C -0.2779
905 P C -0.4589
906 P C -0.4358
907 S C -0.4162
908 V C -0.0193
909 S C -0.0399
910 G C -0.5170
911 A C -0.7916
912 P C -1.6179
913 G C -1.8703
914 Q C -2.5830
915 R C -2.7832
916 V C 0.0000
917 T C -0.5127
918 I C 0.0000
919 S C -0.3989
920 C C 0.0000
921 G C 0.4274
922 Y C 0.7835
923 S C 0.4825
924 F C 0.0000
925 A C 0.1555
926 S C 0.0000
927 Y C 0.7819
928 W C 0.8392
929 I C 0.0000
930 G C 0.0000
931 Y C 0.0000
932 Q C 0.0000
933 Q C 0.0000
934 L C -0.3256
935 P C -0.2457
936 G C -0.7146
937 T C -0.7213
938 A C -0.8501
939 P C 0.0000
940 K C -1.3503
941 L C 0.0000
942 L C 0.0000
943 I C 0.0000
944 Y C 0.0000
945 D C 0.2142
946 G C 0.0000
947 I C 1.6898
948 A C 0.5939
949 A C 0.3227
950 A C -0.0784
951 G C -0.4446
952 T C 0.4445
953 Q C -0.3387
954 Y C 1.9523
955 V C 3.2639
956 L C 3.2904
957 Y C 3.3565
958 Y C 2.5956
959 Y C 1.7871
960 Y C 0.9795
961 G C 0.0000
962 M C 0.6468
963 D C 0.0000
964 V C 0.0000
965 V C -0.2232
966 P C -1.0259
967 D C -1.5879
968 R C -1.6872
969 F C 0.0000
970 S C -0.1400
971 G C 0.0000
972 S C -0.2322
973 K C -0.3950
974 S C -0.3982
975 G C -0.3251
976 T C -0.3122
977 S C -0.4613
978 A C 0.0000
979 S C -0.3437
980 L C 0.0000
981 A C -0.6322
982 I C 0.0000
983 T C -1.6544
984 G C -1.8052
985 L C 0.0000
986 Q C -2.1347
987 S C -1.7183
988 E C -2.3040
989 D C 0.0000
990 E C -1.3413
991 A C 0.0000
992 D C 0.0000
993 Y C 0.0000
994 Y C 0.0000
995 C C 0.0000
996 D C 0.0000
997 T C 0.0000
998 D C 0.0000
999 F C 1.0618
1000 D C -0.1697
1001 Y C 1.3666
1002 Y C 0.0000
1003 D C 0.0000
1004 S C -0.2834
1005 S C -0.3435
1006 G C 0.0000
1007 Y C 0.0000
1008 Y C 0.2441
1009 Y C 0.0000
1010 Y C 0.0000
1011 Y C -0.1101
1012 G C -0.0223
1013 M C -0.0387
1014 D C -0.5293
1015 V C 0.0000
1016 G C 0.0000
1017 G C -0.2479
1018 G C -0.4296
1019 T C 0.0000
1020 K C -0.7679
1021 L C 0.0000
1022 T C 0.0000
1023 V C 0.5047
1024 L C -0.0484
1025 G C -0.9277
1026 Q C -1.6301
1027 P C -1.3485
1028 K C -1.5675
1029 A C -1.1439
1030 A C -0.8853
1031 P C -0.4514
1032 S C -0.2993
1033 V C 0.0000
1034 T C -0.6945
1035 L C 0.0000
1036 F C 0.0000
1037 P C -0.2634
1038 P C 0.0000
1039 S C 0.0000
1040 S C -0.9749
1041 E C -1.5606
1042 E C 0.0000
1043 L C -1.3787
1044 Q C -1.8419
1045 A C -1.3357
1046 N C -2.1784
1047 K C -1.3831
1048 A C 0.0000
1049 T C 0.0000
1050 L C 0.0000
1051 V C 0.0000
1052 C C 0.0000
1053 L C 0.0000
1054 I C 0.0000
1055 S C -0.3351
1056 D C -0.6612
1057 F C 0.0000
1058 Y C 0.0000
1059 P C -0.5486
1060 G C -0.3898
1061 A C -0.1787
1062 V C 0.0184
1063 T C -0.0207
1064 V C 0.0166
1065 A C -0.1758
1066 W C 0.0000
1067 K C -0.7360
1068 A C 0.0000
1069 D C -1.6755
1070 S C -0.9689
1071 S C -0.5114
1072 P C -0.0624
1073 V C 0.5843
1074 K C -0.3173
1075 A C -0.1149
1076 G C -0.5866
1077 V C -0.1156
1078 E C -1.1768
1079 T C -0.5665
1080 T C -0.4821
1081 T C 0.0000
1082 P C -0.6195
1083 S C -0.8237
1084 K C -1.3134
1085 Q C -1.6597
1086 S C -1.1580
1087 N C -1.1685
1088 N C -0.9542
1089 K C -0.8471
1090 Y C -0.5419
1091 A C 0.0000
1092 A C 0.0000
1093 S C 0.0000
1094 S C 0.0000
1095 Y C -0.1220
1096 L C 0.0000
1097 S C -0.0826
1098 L C -0.7578
1099 T C -1.4951
1100 P C 0.0000
1101 E C -2.9563
1102 Q C -2.4323
1103 W C 0.0000
1104 K C -3.0007
1105 S C -2.3159
1106 H C -2.4503
1107 R C -2.9047
1108 S C -1.5126
1109 Y C 0.0000
1110 S C -1.2501
1111 C C 0.0000
1112 Q C -0.9643
1113 V C 0.0000
1114 T C -0.5837
1115 H C -0.9957
1116 E C -2.0604
1117 G C -1.1476
1118 S C -0.6941
1119 T C -0.5953
1120 V C -0.7133
1121 E C -2.1013
1122 K C -1.8095
1123 T C -0.8750
1124 V C -0.8543
1125 A C -1.3304
1126 P C -1.6791
1127 T C -1.6620
1128 E C -2.2610
1129 C C -1.4160
1130 S C -0.8461
1131 D D -0.5640
1132 I D 0.0000
1133 V D 2.1249
1134 L D 0.0000
1135 T D 0.2654
1136 Q D -0.3332
1137 P D -0.6086
1138 P D -0.6110
1139 S D -0.6280
1140 V D -0.3058
1141 S D -0.3219
1142 G D -0.8319
1143 A D 0.0000
1144 P D -1.6549
1145 G D -1.5552
1146 Q D -2.0161
1147 R D -2.4710
1148 V D 0.0000
1149 T D -0.6169
1150 I D 0.0000
1151 S D -0.4111
1152 C D 0.0000
1153 G D 0.2916
1154 Y D 0.9483
1155 S D 0.6724
1156 F D 0.0000
1157 A D 0.5186
1158 S D 0.6186
1159 Y D 0.9212
1160 W D 0.0000
1161 I D 0.0000
1162 G D 0.0000
1163 Y D 0.0000
1164 Q D 0.0000
1165 Q D 0.0000
1166 L D -0.2550
1167 P D -0.2657
1168 G D -0.6306
1169 T D -0.6065
1170 A D -0.7651
1171 P D 0.0000
1172 K D -0.8836
1173 L D -0.1461
1174 L D 0.0000
1175 I D 0.0000
1176 Y D 0.0000
1177 D D 0.0000
1178 G D 0.0000
1179 I D 2.6666
1180 A D 1.3485
1181 A D 1.2820
1182 A D 0.2346
1183 G D -0.4094
1184 T D 0.3216
1185 Q D -0.1375
1186 Y D 1.7585
1187 V D 2.8746
1188 L D 2.9172
1189 Y D 2.1142
1190 Y D 2.6145
1191 Y D 1.5404
1192 Y D 1.4750
1193 G D 0.0000
1194 M D 0.7964
1195 D D 0.0000
1196 V D 0.8687
1197 V D 0.0312
1198 P D -0.7433
1199 D D -0.7933
1200 R D -1.8031
1201 F D 0.0000
1202 S D -0.2080
1203 G D 0.2169
1204 S D -0.1409
1205 K D 0.0000
1206 S D -0.2735
1207 G D -0.1836
1208 T D -0.2052
1209 S D -0.4065
1210 A D 0.0000
1211 S D -0.2545
1212 L D 0.0000
1213 A D -0.7017
1214 I D 0.0000
1215 T D -1.4776
1216 G D -1.5842
1217 L D 0.0000
1218 Q D -1.7492
1219 S D -1.7536
1220 E D -2.2321
1221 D D 0.0000
1222 E D -1.4332
1223 A D 0.0000
1224 D D -0.7296
1225 Y D 0.0000
1226 Y D 0.0000
1227 C D 0.0000
1228 D D 0.0000
1229 T D 0.0000
1230 D D 0.0000
1231 F D 1.7178
1232 D D 0.3471
1233 Y D 0.8656
1234 Y D 0.0000
1235 D D 0.0000
1236 S D -0.3667
1237 S D -0.5227
1238 G D -0.2476
1239 Y D 0.0000
1240 Y D 0.9532
1241 Y D 1.5229
1242 Y D 2.2588
1243 Y D 2.0330
1244 G D 1.0216
1245 M D 0.3519
1246 D D 0.0000
1247 V D 0.0000
1248 G D 0.0000
1249 G D 0.3852
1250 G D -0.5585
1251 T D 0.0000
1252 K D -0.9980
1253 L D 0.0000
1254 T D -0.5807
1255 V D -0.1360
1256 L D 0.0000
1257 G D 0.0000
1258 Q D -0.9986
1259 P D -1.0479
1260 K D -1.4443
1261 A D 0.0000
1262 A D -0.6431
1263 P D -0.5465
1264 S D -0.3155
1265 V D 0.0000
1266 T D 0.0000
1267 L D 0.0000
1268 F D 0.0000
1269 P D -0.3010
1270 P D 0.0000
1271 S D -0.7963
1272 S D -1.3165
1273 E D -2.4384
1274 E D 0.0000
1275 L D -2.1380
1276 Q D -2.3033
1277 A D -1.8446
1278 N D -2.7175
1279 K D -2.3720
1280 A D 0.0000
1281 T D 0.0000
1282 L D 0.0000
1283 V D 0.0000
1284 C D 0.0000
1285 L D 0.0000
1286 I D 0.0000
1287 S D 0.0000
1288 D D -0.8764
1289 F D 0.0000
1290 Y D 0.0000
1291 P D -0.7525
1292 G D -0.4889
1293 A D -0.1788
1294 V D -0.0950
1295 T D -0.1033
1296 V D -0.1828
1297 A D -0.0218
1298 W D 0.0000
1299 K D -0.3900
1300 A D 0.0000
1301 D D -1.3035
1302 S D -0.6755
1303 S D -0.2990
1304 P D 0.1566
1305 V D 0.8940
1306 K D -0.3972
1307 A D -0.1533
1308 G D -0.5529
1309 V D 0.2002
1310 E D -0.9324
1311 T D 0.0000
1312 T D -0.4113
1313 T D -0.3718
1314 P D -0.6932
1315 S D -0.9857
1316 K D -1.6860
1317 Q D -1.8630
1318 S D -1.4416
1319 N D -1.5036
1320 N D -1.2734
1321 K D 0.0000
1322 Y D -0.4348
1323 A D 0.0000
1324 A D 0.0000
1325 S D 0.0000
1326 S D 0.0000
1327 Y D 0.0000
1328 L D 0.0000
1329 S D -0.3723
1330 L D -1.0419
1331 T D -2.0764
1332 P D 0.0000
1333 E D -3.2729
1334 Q D -2.7762
1335 W D -2.5150
1336 K D -3.0949
1337 S D -2.4780
1338 H D -2.5405
1339 R D -2.6086
1340 S D -1.5176
1341 Y D 0.0000
1342 S D 0.0000
1343 C D 0.0000
1344 Q D -0.5130
1345 V D 0.0000
1346 T D -0.5801
1347 H D -1.1204
1348 E D -2.2325
1349 G D -1.4421
1350 S D -0.5384
1351 T D -0.5701
1352 V D -0.2040
1353 E D -0.9753
1354 K D -0.7458
1355 T D -0.3963
1356 V D -0.1121
1357 A D -0.7867
1358 P D -1.3338
1359 T D -1.4453
1360 E D -1.9627
1361 C D -1.0346
1362 S D -0.4771

 

Laboratory of Theory of Biopolymers 2015