Project name: a495dcbb7bf99ad

Status: done

submitted: 2017-11-14 10:16:16, status changed: 2017-11-14 11:43:23
Settings
Chain sequence(s) A: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCDAEFRHDSGYEWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCDAEFRHDSGYEWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9122
Maximal score value
2.1603
Average score
-0.7964
Total score value
-1055.9815

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.2920
2 I A 0.5644
3 V A 0.0000
4 L A -0.4217
5 T A 0.0000
6 Q A -1.7293
7 S A -1.0349
8 P A -1.1869
9 G A -1.1657
10 T A -0.8201
11 L A -0.4975
12 S A -0.8338
13 L A -1.5130
14 S A -2.1028
15 P A -2.3159
16 G A -2.6317
17 E A -3.1341
18 R A -3.3044
19 A A 0.0000
20 T A -0.7645
21 L A 0.0000
22 S A -1.2192
23 C A 0.0000
24 R A -2.4262
25 A A 0.0000
26 S A -1.1484
27 Q A -1.9407
28 S A -1.6060
29 V A 0.0000
30 G A -0.6254
31 S A -0.4005
32 S A 0.1474
33 Y A 1.0774
34 L A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A 0.0000
39 Q A -0.8809
40 K A -1.3288
41 P A -1.2859
42 G A -1.3605
43 Q A -1.9292
44 A A -1.3690
45 P A 0.0000
46 R A -0.8256
47 L A 0.0000
48 L A 0.0000
49 I A 0.0000
50 Y A 0.4901
51 G A 0.5417
52 A A 0.3468
53 F A 0.4388
54 S A -0.0743
55 R A -0.7776
56 A A 0.0000
57 T A -0.4112
58 G A -0.6940
59 I A -0.6780
60 P A -1.2703
61 D A -2.0398
62 R A -1.7690
63 F A 0.0000
64 S A -0.5195
65 G A 0.0000
66 S A -0.3922
67 G A -0.8573
68 S A -0.9210
69 G A -1.2415
70 T A -1.9457
71 D A -2.3737
72 F A 0.0000
73 T A -0.8559
74 L A 0.0000
75 T A -0.7305
76 I A 0.0000
77 S A -2.5636
78 R A -3.4072
79 L A 0.0000
80 E A -1.7681
81 P A -1.6478
82 E A -1.8153
83 D A 0.0000
84 F A 0.0000
85 A A 0.0000
86 V A -0.4991
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 Q A 0.0000
91 Q A 0.0000
92 Y A 0.0260
93 G A -0.4455
94 S A -0.6826
95 S A -0.5073
96 P A -0.6675
97 W A 0.0000
98 T A -0.2532
99 F A 0.0000
100 G A 0.0000
101 Q A -1.6107
102 G A -1.3314
103 T A 0.0000
104 K A -1.1725
105 V A 0.0000
106 E A -1.0901
107 I A 0.0000
108 K A -1.8242
109 R A -2.1069
110 T A -0.4047
111 V A 0.8694
112 A A 0.2925
113 A A 0.1107
114 P A -0.1165
115 S A -0.3345
116 V A 0.0000
117 F A 0.1140
118 I A 0.0000
119 F A 0.0000
120 P A 0.0000
121 P A 0.0000
122 S A -1.6998
123 D A -3.1081
124 E A -3.1664
125 Q A 0.0000
126 L A -2.0617
127 K A -2.8836
128 S A -1.7543
129 G A -1.1620
130 T A -0.7141
131 A A 0.0000
132 S A 0.0000
133 V A 0.0000
134 V A 0.0000
135 C A 0.0000
136 L A 0.0000
137 L A 0.0000
138 N A 0.0000
139 N A -0.7600
140 F A 0.0000
141 Y A 0.0000
142 P A -1.5135
143 R A -2.5234
144 E A -3.0027
145 A A -2.3764
146 K A -2.4937
147 V A -1.4323
148 Q A -1.3195
149 W A 0.0000
150 K A -0.8692
151 V A 0.0000
152 D A -1.7503
153 N A -1.4107
154 A A -0.6340
155 L A -0.2210
156 Q A -1.3490
157 S A -1.0464
158 G A -1.3371
159 N A -2.0166
160 S A -1.5872
161 Q A -1.3118
162 E A -1.7856
163 S A 0.0000
164 V A -0.3237
165 T A 0.0000
166 E A -2.0350
167 Q A 0.0000
168 D A -1.9524
169 S A -1.9589
170 K A -2.1948
171 D A -1.7948
172 S A -2.0387
173 T A 0.0000
174 Y A 0.0000
175 S A 0.0000
176 L A 0.0000
177 S A 0.0000
178 S A 0.0000
179 T A -0.7116
180 L A 0.0000
181 T A -0.5333
182 L A -0.5736
183 S A -0.8492
184 K A -1.4074
185 A A -1.3493
186 D A -1.7001
187 Y A 0.0000
188 E A -2.1253
189 K A -2.8179
190 H A -2.4780
191 K A -2.6876
192 V A -1.4446
193 Y A 0.0000
194 A A -1.1773
195 C A 0.0000
196 E A -1.2692
197 V A 0.0000
198 T A -1.2416
199 H A 0.0000
200 Q A -1.7009
201 G A -0.3833
202 L A -0.0655
203 S A -0.4062
204 S A -0.3560
205 P A -0.5632
206 V A -0.1936
207 T A -0.8259
208 K A -1.3272
209 S A -1.0242
210 F A 0.0000
211 N A -2.1324
212 R A -2.1681
213 G A -2.0678
214 E A -2.4734
215 C A -1.7519
216 Q B -0.7484
217 V B 0.2504
218 Q B -0.8496
219 L B 0.0000
220 V B 0.2149
221 E B 0.0000
222 S B -0.5407
223 G B -0.8278
224 G B -0.5375
225 G B 0.0488
226 V B 0.3109
227 V B 0.0000
228 Q B -1.7986
229 P B -2.0811
230 G B -2.2838
231 R B -2.8087
232 S B -2.1467
233 L B -1.5901
234 R B -2.1902
235 L B 0.0000
236 S B -0.6506
237 C B 0.0000
238 A B -0.3255
239 A B -0.2079
240 S B -0.2428
241 G B 0.3238
242 F B 1.5827
243 T B 0.7223
244 F B 0.0000
245 S B -0.5631
246 S B 0.1948
247 Y B 0.2630
248 T B -0.1443
249 M B 0.0000
250 H B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B -0.5894
254 Q B -0.9734
255 A B -1.2405
256 P B -1.0847
257 G B -1.4866
258 K B -2.4953
259 G B -1.8000
260 L B -1.1391
261 E B -1.3761
262 W B 0.0000
263 V B 0.0000
264 T B 0.0000
265 F B 0.0000
266 I B 0.0000
267 S B -0.7682
268 Y B -0.2940
269 D B -2.1613
270 G B -2.2114
271 N B -2.3891
272 N B -1.9341
273 K B -0.5795
274 Y B 0.4017
275 Y B -0.4196
276 A B -1.3593
277 D B -2.6121
278 S B -2.1917
279 V B 0.0000
280 K B -2.7220
281 G B -2.0837
282 R B -2.5170
283 F B 0.0000
284 T B -1.1218
285 I B 0.0000
286 S B -0.7248
287 R B -1.2092
288 D B -2.0144
289 N B -2.0412
290 S B -1.7598
291 K B -2.5621
292 N B -1.8244
293 T B -1.1543
294 L B 0.0000
295 Y B -0.5905
296 L B 0.0000
297 Q B -1.5905
298 M B 0.0000
299 N B -2.2973
300 S B -2.0190
301 L B 0.0000
302 R B -3.1758
303 A B -2.0341
304 E B -2.4782
305 D B 0.0000
306 T B -0.7240
307 A B 0.0000
308 I B 0.3011
309 Y B 0.0000
310 Y B 0.0000
311 C B 0.0000
312 D B 0.0000
313 A B 0.0000
314 E B 0.0000
315 F B 0.0000
316 R B 0.0000
317 H B -1.0608
318 D B -1.8088
319 S B -0.7257
320 G B 0.0000
321 Y B -0.5469
322 E B -0.8945
323 W B 0.0000
324 G B 0.0000
325 Q B -1.2399
326 G B 0.0000
327 T B 0.0177
328 L B 0.4391
329 V B 0.0000
330 T B -0.0860
331 V B 0.0000
332 S B -0.8261
333 S B -0.6007
334 A B -0.5428
335 S B -0.7752
336 T B -0.9779
337 K B -1.7735
338 G B -1.5493
339 P B -0.8926
340 S B -0.6498
341 V B 0.0000
342 F B -0.7635
343 P B -1.2688
344 L B 0.0000
345 A B -0.7947
346 P B -0.6676
347 S B -1.1546
348 S B -1.2277
349 K B -1.9582
350 S B -1.3981
351 T B -0.9553
352 S B -1.0726
353 G B -0.7766
354 G B -0.7104
355 T B -0.5303
356 A B 0.0000
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.5917
364 D B -1.0059
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.5287
369 P B -0.5659
370 V B -0.4483
371 T B -0.3825
372 V B -0.2885
373 S B -0.3004
374 W B 0.0000
375 N B -0.7201
376 S B -0.6081
377 G B -0.3331
378 A B -0.1215
379 L B 0.1111
380 T B -0.0596
381 S B -0.0971
382 G B -0.0797
383 V B 0.3408
384 H B -0.0334
385 T B 0.0879
386 F B 0.0000
387 P B -0.1906
388 A B 0.3459
389 V B 0.4840
390 L B 0.9539
391 Q B -0.6108
392 S B -0.4341
393 S B -0.4857
394 G B -0.2128
395 L B -0.2604
396 Y B 0.0000
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0724
404 V B 0.0000
405 P B -0.5754
406 S B -0.6001
407 S B -0.6706
408 S B -0.7824
409 L B -0.9168
410 G B -1.1879
411 T B -0.9248
412 Q B -1.3825
413 T B -1.3214
414 Y B 0.0000
415 I B -1.3749
416 C B 0.0000
417 N B -1.5017
418 V B 0.0000
419 N B -1.7474
420 H B 0.0000
421 K B -1.9114
422 P B -1.2956
423 S B -1.7500
424 N B -2.2594
425 T B -1.9671
426 K B -2.4824
427 V B -1.7289
428 D B -2.5626
429 K B -2.0734
430 R B -2.6049
431 V B 0.0000
432 E B -2.6717
433 P B -1.8238
434 K B -2.1874
435 S B -1.8649
436 C B -1.8765
437 D B -2.2400
438 K B -2.4220
439 T B -1.6453
440 H B -1.4752
441 T B -1.5225
442 C B 0.0000
443 P B -1.1444
444 P B -0.5005
445 C B 0.2750
446 P B -0.3384
447 A B -0.3315
448 P B -0.6650
449 E B -0.7806
450 L B 0.8986
451 L B 1.5094
452 G B 0.2293
453 G B -0.0820
454 P B -0.3449
455 S B 0.1884
456 V B 0.0000
457 F B 1.9585
458 L B 1.5623
459 F B 2.1360
460 P B 0.4832
461 P B 0.0000
462 K B -2.0521
463 P B -1.5248
464 K B -1.7168
465 D B -1.5537
466 T B 0.0000
467 L B 0.0000
468 M B 0.4060
469 I B 1.5015
470 S B -0.0429
471 R B -1.3776
472 T B -0.7132
473 P B 0.0000
474 E B -0.6745
475 V B 0.0000
476 T B 1.1169
477 C B 0.0000
478 V B 0.4988
479 V B 0.0000
480 V B -0.2897
481 D B -1.0956
482 V B 0.0000
483 S B -1.9613
484 H B -2.3105
485 E B -2.7891
486 D B -2.3411
487 P B -2.2126
488 E B -2.4260
489 V B 0.0000
490 K B -2.4207
491 F B -1.9730
492 N B -1.6055
493 W B 0.0000
494 Y B -1.2596
495 V B -0.9511
496 D B -2.0981
497 G B -0.8029
498 V B 0.6860
499 E B -0.7343
500 V B 0.1336
501 H B -1.2550
502 N B -1.2955
503 A B -1.2411
504 K B -2.3773
505 T B -1.8959
506 K B -3.1748
507 P B -2.4803
508 R B -3.5292
509 E B -3.9122
510 E B -3.1866
511 Q B -2.5339
512 Y B -1.2617
513 N B -1.3486
514 S B -1.0913
515 T B -1.5863
516 Y B -2.3928
517 R B -2.2199
518 V B 0.0000
519 V B -1.0871
520 S B 0.0000
521 V B -0.0028
522 L B 0.0000
523 T B -0.2498
524 V B 0.0000
525 L B 0.9788
526 H B -0.0616
527 Q B -1.2827
528 D B -1.2042
529 W B 0.0000
530 L B -0.8985
531 N B -2.0262
532 G B -2.0931
533 K B -2.2756
534 E B -2.3939
535 Y B 0.0000
536 K B -1.9119
537 C B 0.0000
538 K B -2.0464
539 V B 0.0000
540 S B -1.4247
541 N B -1.7076
542 K B -2.0914
543 A B -1.2576
544 L B -0.5866
545 P B -0.4298
546 A B -0.3860
547 P B -0.6051
548 I B -0.6417
549 E B -1.6559
550 K B -1.3742
551 T B -1.1548
552 I B -0.0061
553 S B -1.7291
554 K B -1.8570
555 A B -1.5291
556 K B -2.4880
557 G B -2.1650
558 Q B -2.1555
559 P B -2.2094
560 R B -2.6176
561 E B -2.5877
562 P B 0.0000
563 Q B -1.3720
564 V B 0.0000
565 Y B 0.0000
566 T B -0.7061
567 L B -0.3041
568 P B -0.3283
569 P B 0.0000
570 S B -1.2719
571 R B -2.4624
572 D B -2.4301
573 E B 0.0000
574 L B -1.2563
575 T B -1.2630
576 K B -1.9444
577 N B -2.3766
578 Q B -2.4150
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B -0.6441
587 G B -1.1297
588 F B 0.0000
589 Y B -1.2925
590 P B 0.0000
591 S B 0.0584
592 D B -0.8979
593 I B -0.6219
594 A B -0.6513
595 V B 0.0000
596 E B -1.5560
597 W B 0.0000
598 E B -2.3013
599 S B 0.0000
600 N B -2.4059
601 G B -2.0001
602 Q B -2.4483
603 P B -2.4332
604 E B -2.9409
605 N B -2.4146
606 N B -1.7135
607 Y B -1.1296
608 K B -0.5251
609 T B -0.3533
610 T B 0.0000
611 P B 0.0379
612 P B 0.2759
613 V B 0.8302
614 L B 1.0509
615 D B -0.3571
616 S B -1.2756
617 D B -1.9921
618 G B -0.8888
619 S B -0.7757
620 F B 0.0000
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.9376
628 V B 0.0000
629 D B -2.5471
630 K B -2.7237
631 S B -2.6222
632 R B -3.4573
633 W B 0.0000
634 Q B -2.7372
635 Q B -2.7363
636 G B -1.7372
637 N B -1.7258
638 V B -0.6950
639 F B 0.0000
640 S B -1.1746
641 C B 0.0000
642 S B -0.8922
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.1870
647 A B -1.8003
648 L B 0.0000
649 H B -1.8338
650 N B -1.7675
651 H B -1.3154
652 Y B -0.6262
653 T B -1.0202
654 Q B -1.2234
655 K B -1.2227
656 S B -0.4762
657 L B 0.0000
658 S B 0.0715
659 L B 0.6909
660 S B 0.2210
661 P B -0.2312
662 G B 0.0000
663 K B -0.9249
664 E C -1.4480
665 I C 0.4187
666 V C 0.0000
667 L C 0.5569
668 T C 0.0000
669 Q C -0.8267
670 S C -0.6677
671 P C -0.7847
672 G C -0.8488
673 T C -0.6283
674 L C -0.3393
675 S C -0.6152
676 L C -1.2550
677 S C -1.8249
678 P C -2.0494
679 G C -2.4667
680 E C -2.8293
681 R C -3.1168
682 A C 0.0000
683 T C -0.6620
684 L C 0.0000
685 S C -0.5301
686 C C 0.0000
687 R C -0.8287
688 A C 0.0000
689 S C -0.8134
690 Q C -1.7411
691 S C -1.3665
692 V C 0.0000
693 G C -0.4889
694 S C -0.4540
695 S C 0.0831
696 Y C 0.7952
697 L C 0.0000
698 A C 0.0000
699 W C 0.0000
700 Y C 0.0000
701 Q C 0.0000
702 Q C -1.0268
703 K C -1.2904
704 P C -0.9903
705 G C -1.2541
706 Q C -1.5017
707 A C -1.3374
708 P C 0.0000
709 R C -1.8369
710 L C 0.0000
711 L C 0.0000
712 I C 0.0000
713 Y C 0.5633
714 G C 0.4647
715 A C 0.2642
716 F C 0.4009
717 S C -0.0905
718 R C -0.7855
719 A C 0.0000
720 T C -0.3988
721 G C -0.6576
722 I C -0.5941
723 P C -1.3105
724 D C -2.0598
725 R C -1.7645
726 F C 0.0000
727 S C -0.5401
728 G C 0.0000
729 S C -0.3249
730 G C -0.6252
731 S C -0.7104
732 G C -0.9352
733 T C -1.1836
734 D C -1.1512
735 F C 0.0000
736 T C -0.4741
737 L C 0.0000
738 T C -0.7262
739 I C 0.0000
740 S C -2.4349
741 R C -3.3333
742 L C 0.0000
743 E C -2.0357
744 P C -1.8673
745 E C -2.2006
746 D C 0.0000
747 F C -0.9420
748 A C 0.0000
749 V C -0.4160
750 Y C 0.0000
751 Y C 0.0000
752 C C 0.0000
753 Q C 0.0000
754 Q C 0.0000
755 Y C -0.0351
756 G C -0.4023
757 S C -0.6435
758 S C -0.4817
759 P C -0.6730
760 W C -0.3436
761 T C -0.2289
762 F C 0.0000
763 G C 0.0000
764 Q C -1.2547
765 G C 0.0000
766 T C 0.0000
767 K C -1.2264
768 V C 0.0000
769 E C -0.9135
770 I C 0.0000
771 K C -1.4247
772 R C -1.6109
773 T C -0.0779
774 V C 1.0311
775 A C 0.3416
776 A C 0.0504
777 P C -0.3737
778 S C -0.3636
779 V C 0.0000
780 F C 0.1094
781 I C 0.0000
782 F C 0.0000
783 P C 0.0000
784 P C 0.0000
785 S C 0.0000
786 D C -3.1037
787 E C -3.1966
788 Q C 0.0000
789 L C -2.2833
790 K C -2.8358
791 S C -1.7473
792 G C -1.1845
793 T C -0.7147
794 A C 0.0000
795 S C 0.0000
796 V C 0.0000
797 V C 0.0000
798 C C 0.0000
799 L C 0.0000
800 L C 0.0000
801 N C 0.0000
802 N C -1.2306
803 F C 0.0000
804 Y C 0.0000
805 P C -1.7641
806 R C -3.0390
807 E C -3.3182
808 A C -2.5016
809 K C -2.4608
810 V C -1.2039
811 Q C -0.9935
812 W C 0.0000
813 K C -0.6268
814 V C -0.8182
815 D C -1.7456
816 N C -1.3720
817 A C -0.3688
818 L C 0.3349
819 Q C -0.9976
820 S C -0.8040
821 G C -1.2512
822 N C -1.9724
823 S C -1.5371
824 Q C -1.1932
825 E C -1.5449
826 S C 0.0000
827 V C 0.3272
828 T C -0.5820
829 E C -2.0387
830 Q C 0.0000
831 D C -2.5894
832 S C -2.5418
833 K C -2.9443
834 D C -3.2412
835 S C 0.0000
836 T C -2.0471
837 Y C 0.0000
838 S C 0.0000
839 L C -0.2390
840 S C 0.0000
841 S C 0.0000
842 T C 0.0000
843 L C 0.0000
844 T C -0.5199
845 L C -0.5257
846 S C -1.0284
847 K C -1.7543
848 A C -1.7827
849 D C -2.0651
850 Y C 0.0000
851 E C -3.5325
852 K C -3.4370
853 H C -3.0179
854 K C -3.2921
855 V C -1.5490
856 Y C 0.0000
857 A C -0.9383
858 C C 0.0000
859 E C -0.9032
860 V C 0.0000
861 T C -1.1176
862 H C 0.0000
863 Q C -1.7914
864 G C -0.4127
865 L C -0.1129
866 S C -0.4219
867 S C -0.3287
868 P C -0.4461
869 V C 0.0549
870 T C -0.4587
871 K C -0.7976
872 S C -0.8226
873 F C 0.0000
874 N C -2.3568
875 R C -2.4737
876 G C -2.0067
877 E C -1.5297
878 C C -1.0640
879 Q D -1.2471
880 V D -0.6007
881 Q D -1.0526
882 L D 0.0000
883 V D 0.9737
884 E D 0.0000
885 S D -0.3148
886 G D -0.6622
887 G D 0.0000
888 G D 0.2725
889 V D 0.5108
890 V D 0.0000
891 Q D -1.9428
892 P D -2.1908
893 G D -2.3511
894 R D -2.7210
895 S D -1.7675
896 L D -0.8111
897 R D -1.7246
898 L D 0.0000
899 S D -0.4572
900 C D 0.0000
901 A D -0.0276
902 A D 0.0000
903 S D -0.6684
904 G D -0.5698
905 F D 0.0769
906 T D 0.0040
907 F D 0.0000
908 S D -0.6601
909 S D -0.0246
910 Y D 0.0082
911 T D -0.3381
912 M D 0.0000
913 H D 0.0000
914 W D 0.0000
915 V D 0.0000
916 R D 0.0000
917 Q D -0.7820
918 A D -1.1206
919 P D -1.0538
920 G D -1.4704
921 K D -2.4162
922 G D -1.6762
923 L D -0.9550
924 E D -1.0274
925 W D 0.0000
926 V D 0.0000
927 T D 0.0000
928 F D 0.0000
929 I D 0.0000
930 S D 0.0000
931 Y D -0.2773
932 D D -2.0000
933 G D -1.8960
934 N D -2.2811
935 N D -1.9627
936 K D -0.9401
937 Y D 0.1005
938 Y D -0.6793
939 A D -1.3148
940 D D -2.6161
941 S D -2.0906
942 V D 0.0000
943 K D -2.8256
944 G D -2.2142
945 R D -2.7268
946 F D 0.0000
947 T D -1.1626
948 I D 0.0000
949 S D -0.5598
950 R D -0.9628
951 D D -1.6656
952 N D -1.5916
953 S D -1.5719
954 K D -2.4189
955 N D -1.8351
956 T D -0.9346
957 L D 0.0000
958 Y D -0.4612
959 L D 0.0000
960 Q D -1.2215
961 M D 0.0000
962 N D -2.1313
963 S D -2.0107
964 L D 0.0000
965 R D -3.2303
966 A D -2.0721
967 E D -2.4655
968 D D 0.0000
969 T D -0.6487
970 A D 0.0000
971 I D 0.4727
972 Y D 0.0000
973 Y D 0.0000
974 C D 0.0000
975 D D 0.0000
976 A D 0.0000
977 E D 0.0000
978 F D 0.0000
979 R D -0.6613
980 H D -0.9986
981 D D -1.7665
982 S D -0.6642
983 G D 0.0000
984 Y D -0.5318
985 E D -1.0041
986 W D 0.0000
987 G D 0.0000
988 Q D -0.9220
989 G D -0.1864
990 T D 0.1495
991 L D 0.4760
992 V D 0.0000
993 T D -0.0464
994 V D 0.0000
995 S D -0.8636
996 S D -0.6743
997 A D -0.6275
998 S D -0.8896
999 T D -1.1002
1000 K D -2.0088
1001 G D -1.5730
1002 P D -0.7091
1003 S D -0.3698
1004 V D 0.0000
1005 F D -0.8180
1006 P D -1.4239
1007 L D 0.0000
1008 A D 0.0000
1009 P D -0.5490
1010 S D 0.0000
1011 S D -0.8822
1012 K D -1.3658
1013 S D -0.9155
1014 T D -0.7969
1015 S D -0.7919
1016 G D -0.7699
1017 G D -0.6960
1018 T D -0.5341
1019 A D 0.0000
1020 A D -0.0038
1021 L D 0.0000
1022 G D 0.0000
1023 C D 0.0000
1024 L D 0.0000
1025 V D 0.0000
1026 K D -0.1829
1027 D D -0.7499
1028 Y D 0.0000
1029 F D 0.0000
1030 P D 0.0000
1031 E D -0.7319
1032 P D -0.7682
1033 V D -0.6163
1034 T D -0.4754
1035 V D -0.0486
1036 S D -0.2725
1037 W D 0.0000
1038 N D -0.9179
1039 S D -0.6704
1040 G D -0.3958
1041 A D -0.2194
1042 L D -0.0073
1043 T D -0.1226
1044 S D -0.1219
1045 G D -0.2764
1046 V D 0.2848
1047 H D -0.0433
1048 T D 0.1753
1049 F D 0.0000
1050 P D -0.0418
1051 A D 0.2813
1052 V D 0.6083
1053 L D 0.7290
1054 Q D -0.4900
1055 S D -0.3704
1056 S D -0.1449
1057 G D -0.5868
1058 L D -0.1902
1059 Y D 0.0590
1060 S D 0.0000
1061 L D 0.0749
1062 S D 0.0000
1063 S D 0.0000
1064 V D 0.0000
1065 V D 0.0000
1066 T D -0.0850
1067 V D 0.0000
1068 P D -0.5955
1069 S D -0.6306
1070 S D -0.7111
1071 S D -0.8617
1072 L D 0.0000
1073 G D -1.2704
1074 T D -0.9646
1075 Q D -1.3993
1076 T D -1.4209
1077 Y D 0.0000
1078 I D -1.6313
1079 C D 0.0000
1080 N D 0.0000
1081 V D 0.0000
1082 N D -1.8123
1083 H D 0.0000
1084 K D -2.7110
1085 P D -1.7362
1086 S D -1.9522
1087 N D -2.5166
1088 T D -2.0665
1089 K D -2.5685
1090 V D -1.7215
1091 D D -2.6296
1092 K D -2.3549
1093 R D -2.9685
1094 V D 0.0000
1095 E D -2.7116
1096 P D -1.6393
1097 K D -1.5281
1098 S D -1.6387
1099 C D -1.2557
1100 D D -2.0735
1101 K D -2.4601
1102 T D -1.6713
1103 H D -1.8786
1104 T D -1.8526
1105 C D -1.3673
1106 P D -1.0724
1107 P D -0.9137
1108 C D -0.2980
1109 P D -0.6146
1110 A D 0.0000
1111 P D -0.7911
1112 E D -1.2231
1113 L D 0.2413
1114 L D 1.1956
1115 G D 0.0697
1116 G D 0.0050
1117 P D 0.0343
1118 S D 0.3520
1119 V D 0.8947
1120 F D 2.1603
1121 L D 0.0000
1122 F D 2.0125
1123 P D 0.3817
1124 P D 0.0000
1125 K D -1.9677
1126 P D -1.2848
1127 K D -0.9689
1128 D D -1.1685
1129 T D 0.0000
1130 L D 0.0000
1131 M D 0.8214
1132 I D 1.7557
1133 S D 0.1718
1134 R D -0.9390
1135 T D -0.5738
1136 P D 0.0000
1137 E D -1.2071
1138 V D 0.0000
1139 T D 0.8480
1140 C D 0.0000
1141 V D 0.0000
1142 V D 0.0000
1143 V D 0.3909
1144 D D -0.1187
1145 V D 0.0000
1146 S D -1.7674
1147 H D -2.3347
1148 E D -2.8155
1149 D D 0.0000
1150 P D -2.4081
1151 E D -2.8753
1152 V D 0.0000
1153 K D -2.6001
1154 F D 0.0000
1155 N D -1.9204
1156 W D 0.0000
1157 Y D -1.4264
1158 V D -0.8053
1159 D D -1.7203
1160 G D -0.7473
1161 V D 0.5619
1162 E D -1.1899
1163 V D -0.0490
1164 H D -1.3460
1165 N D -1.2567
1166 A D -1.0077
1167 K D -2.0107
1168 T D 0.0000
1169 K D -1.9700
1170 P D -1.8052
1171 R D -2.5186
1172 E D -2.3638
1173 E D -1.8239
1174 Q D -1.4902
1175 Y D -0.5615
1176 N D -0.8051
1177 S D -0.7842
1178 T D -0.9309
1179 Y D 0.0000
1180 R D -1.3021
1181 V D 0.0000
1182 V D -0.6019
1183 S D 0.0000
1184 V D -0.0748
1185 L D 0.0000
1186 T D -0.4425
1187 V D 0.3420
1188 L D 0.8769
1189 H D -0.0656
1190 Q D -1.2697
1191 D D -1.1220
1192 W D -1.0018
1193 L D -1.0161
1194 N D -1.9064
1195 G D -2.0873
1196 K D -2.1054
1197 E D -2.2884
1198 Y D 0.0000
1199 K D -2.1728
1200 C D 0.0000
1201 K D -2.0467
1202 V D 0.0000
1203 S D -1.4918
1204 N D -1.8428
1205 K D -2.0481
1206 A D -1.2439
1207 L D -0.5486
1208 P D -0.4667
1209 A D -0.3176
1210 P D -0.4790
1211 I D -0.4865
1212 E D -1.7934
1213 K D -1.6987
1214 T D -1.3369
1215 I D -0.1689
1216 S D -1.8204
1217 K D -2.1138
1218 A D -1.6225
1219 K D -2.4986
1220 G D -2.0823
1221 Q D -2.1880
1222 P D -2.2337
1223 R D -2.7247
1224 E D -2.1569
1225 P D 0.0000
1226 Q D -1.0992
1227 V D 0.0000
1228 Y D 0.0000
1229 T D 0.0000
1230 L D -0.1277
1231 P D -0.4860
1232 P D -0.6877
1233 S D -1.1423
1234 R D -2.2810
1235 D D -2.4338
1236 E D 0.0000
1237 L D -0.3919
1238 T D -0.9521
1239 K D -2.0217
1240 N D -2.5335
1241 Q D -2.3653
1242 V D 0.0000
1243 S D 0.0000
1244 L D 0.0000
1245 T D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 V D 0.0000
1249 K D 0.0000
1250 G D -0.9253
1251 F D 0.0000
1252 Y D -1.2519
1253 P D 0.0000
1254 S D -0.2098
1255 D D -1.0513
1256 I D 0.0000
1257 A D -0.5831
1258 V D 0.0000
1259 E D -0.9060
1260 W D 0.0000
1261 E D -1.6927
1262 S D 0.0000
1263 N D -1.9887
1264 G D -1.7479
1265 Q D -2.1362
1266 P D -1.8562
1267 E D -2.0645
1268 N D -1.9971
1269 N D -1.6542
1270 Y D -0.9108
1271 K D -0.4529
1272 T D -0.2791
1273 T D 0.0000
1274 P D 0.0657
1275 P D 0.3430
1276 V D 0.9169
1277 L D 1.1398
1278 D D -0.2605
1279 S D -1.2482
1280 D D -1.9792
1281 G D -0.8945
1282 S D -0.6916
1283 F D 0.2063
1284 F D 0.0000
1285 L D 0.0000
1286 Y D 0.0000
1287 S D 0.0000
1288 K D 0.0000
1289 L D 0.0000
1290 T D -1.0032
1291 V D 0.0000
1292 D D -2.9514
1293 K D -3.0281
1294 S D -2.4882
1295 R D -2.6834
1296 W D 0.0000
1297 Q D -3.0119
1298 Q D -2.7531
1299 G D -1.9377
1300 N D -1.6084
1301 V D -0.5510
1302 F D 0.0000
1303 S D -0.9729
1304 C D 0.0000
1305 S D 0.0000
1306 V D 0.0000
1307 M D 0.0000
1308 H D 0.0000
1309 E D -1.3018
1310 A D -1.8089
1311 L D 0.0000
1312 H D -1.7972
1313 N D -1.8333
1314 H D -1.2494
1315 Y D -0.7268
1316 T D -0.9725
1317 Q D -1.1230
1318 K D -1.0006
1319 S D -0.2153
1320 L D 0.0000
1321 S D -0.1810
1322 L D 1.0575
1323 S D -0.0309
1324 P D -0.5755
1325 G D -1.2035
1326 K D -1.6314

 

Laboratory of Theory of Biopolymers 2015