Project name: 1JD5_full_Valen

Status: done

submitted: 2018-10-09 14:35:34, status changed: 2018-10-09 14:43:05
Settings
Chain sequence(s) A: GNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEES
B: AIAYFIPD
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0461
Maximal score value
1.8341
Average score
-0.7369
Total score value
-83.272

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
214 G A -0.5525
215 N A -0.6061
216 Y A 0.6668
217 F A 1.4952
218 P A 0.1717
219 Q A -0.7332
220 Y A -0.6261
221 P A -0.4288
222 E A -1.5834
223 Y A -0.6086
224 A A -0.0049
225 I A 0.7302
226 E A -1.6748
227 T A -0.8548
228 A A -0.6793
229 R A 0.0000
230 L A -1.6851
231 R A -2.4926
232 T A -1.3960
233 F A 0.0000
234 E A -2.5243
235 A A -1.3072
236 W A 0.0000
237 P A -1.9313
238 R A -3.0864
239 N A -2.6436
240 L A -2.6253
241 K A -3.5820
242 Q A 0.0000
243 K A -2.4658
244 P A -2.3223
245 H A -2.4753
246 Q A -2.1491
247 L A 0.0000
248 A A 0.0000
249 E A -2.3841
250 A A 0.0000
251 G A 0.0000
252 F A 0.0000
253 F A 0.0000
254 Y A 0.0000
255 T A -0.0526
256 G A -0.1133
257 V A 1.1044
258 G A -0.2477
259 D A -0.8662
260 R A -0.5711
261 V A 0.0000
262 R A -0.3410
263 C A 0.0000
264 F A 0.0000
265 S A 0.0000
266 C A -0.2245
267 G A 0.0000
268 G A 0.0000
269 G A 0.0000
270 L A 0.0000
271 M A -0.4565
272 D A -2.0241
273 W A 0.0000
274 N A -3.1905
275 D A -3.8352
276 N A -3.1033
277 D A -2.6059
278 E A -1.8947
279 P A 0.0000
280 W A 0.0000
281 E A -0.8180
282 Q A 0.0000
283 H A 0.0000
284 A A 0.0000
285 L A 0.0000
286 W A 0.0000
287 L A 0.0000
288 S A -1.3335
289 Q A -1.7760
290 C A 0.0000
291 R A -1.1474
292 F A 0.0000
293 V A 0.0000
294 K A -0.4625
295 L A 1.0076
296 M A 0.6728
297 K A -0.2347
298 G A -0.2279
299 Q A -0.5468
300 L A 0.4225
301 Y A -0.1525
302 I A 0.0000
303 D A -1.5076
304 T A -0.7699
305 V A 0.0000
306 A A -1.0859
307 A A -0.8181
308 K A -1.0557
309 P A -0.4708
310 V A 0.5529
311 L A 0.0000
312 A A -1.8598
313 E A -3.1645
314 E A -2.4970
315 K A -2.8858
316 E A -4.0461
317 E A -3.7599
318 S A -2.0069
1 A B 0.0000
2 I B 0.9567
3 A B 1.1710
4 Y B 1.2772
5 F B 1.6973
6 I B 1.8341
7 P B -0.2004
8 D B -1.2552

 

Laboratory of Theory of Biopolymers 2015