Project name: a5aaca45c53439a

Status: done

submitted: 2017-11-14 10:16:27, status changed: 2017-11-14 11:43:08
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCYLVLYLIIVVGWYQQKPGKAPKLLIYYTSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGNTLPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCYLVLYLIIVVGWYQQKPGKAPKLLIYYTSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGNTLPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIGYISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSLARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIGYISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSLARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9183
Maximal score value
2.8741
Average score
-0.7021
Total score value
-929.6412

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -0.0745
2 I A 1.6996
3 Q A 0.0000
4 M A 0.7393
5 T A 0.0000
6 Q A -0.6020
7 S A -0.8455
8 P A -0.7542
9 S A -1.1309
10 S A -1.2344
11 L A -0.7724
12 S A -0.9101
13 A A 0.0000
14 S A -1.0073
15 V A -0.3755
16 G A -1.1220
17 D A -2.0094
18 R A -2.4963
19 V A 0.0000
20 T A -0.6914
21 I A 0.0000
22 T A -0.1749
23 C A 0.0000
24 Y A 1.3073
25 L A 0.0000
26 V A 2.4981
27 L A 2.8741
28 Y A 2.6445
29 L A 0.0000
30 I A 2.8149
31 I A 1.9870
32 V A 1.5688
33 V A 0.0000
34 G A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.3787
39 K A -1.8587
40 P A -1.5999
41 G A -1.6685
42 K A -2.5608
43 A A -1.6353
44 P A 0.0000
45 K A -1.1684
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.5342
50 Y A 1.5085
51 T A 0.6946
52 S A -0.3764
53 R A -1.3172
54 L A -0.3815
55 H A -0.4592
56 S A -0.5552
57 G A -0.4493
58 V A -0.3054
59 P A -0.4526
60 S A -0.3807
61 R A -0.7802
62 F A 0.0000
63 S A -0.5351
64 G A -0.2809
65 S A -0.3881
66 G A 0.1342
67 S A 0.7087
68 G A 1.6598
69 T A 1.1954
70 D A 0.2258
71 F A 0.0000
72 T A -0.2951
73 F A 0.0000
74 T A -0.6020
75 I A 0.0000
76 S A -1.4420
77 S A -1.3376
78 L A 0.0000
79 Q A -1.0169
80 P A -1.4617
81 E A -2.0346
82 D A 0.0000
83 I A -1.1757
84 A A 0.0000
85 T A -1.2046
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 G A 0.0456
92 N A -0.0796
93 T A -0.3724
94 L A 0.2898
95 P A 0.0739
96 Y A -0.0192
97 T A -0.1424
98 F A 0.0000
99 G A 0.0000
100 Q A -1.4870
101 G A -1.5342
102 T A 0.0000
103 K A -2.0418
104 V A 0.0000
105 E A -1.5584
106 I A 0.0000
107 K A -1.1107
108 R A -0.8575
109 T A 0.1964
110 V A 1.1556
111 A A 0.4772
112 A A 0.1091
113 P A -0.0531
114 S A -0.1111
115 V A 0.0213
116 F A 0.1766
117 I A 0.0000
118 F A 0.0000
119 P A -0.4842
120 P A 0.0000
121 S A -1.9110
122 D A -3.3123
123 E A -3.2944
124 Q A 0.0000
125 L A 0.0000
126 K A -3.0151
127 S A -1.8426
128 G A -1.2373
129 T A -0.8333
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -0.7676
139 F A 0.0000
140 Y A 0.0000
141 P A -1.6571
142 R A -3.2166
143 E A -3.3186
144 A A -2.5657
145 K A -2.6273
146 V A -1.5386
147 Q A -1.4367
148 W A 0.0000
149 K A -0.4846
150 V A -0.8121
151 D A -1.5718
152 N A -1.2579
153 A A -0.2890
154 L A 0.4071
155 Q A -1.0533
156 S A -0.8562
157 G A -1.2741
158 N A -1.9724
159 S A -1.6168
160 Q A -1.3090
161 E A -1.8783
162 S A 0.0000
163 V A -0.8813
164 T A -1.1412
165 E A -2.2950
166 Q A 0.0000
167 D A -2.2892
168 S A -2.2454
169 K A -2.5983
170 D A -2.4305
171 S A 0.0000
172 T A -1.6385
173 Y A 0.0000
174 S A 0.0000
175 L A -0.7163
176 S A 0.0000
177 S A 0.0000
178 T A -0.7097
179 L A 0.0000
180 T A -0.4818
181 L A -0.6149
182 S A -1.0438
183 K A -1.6540
184 A A -1.7006
185 D A -2.3911
186 Y A 0.0000
187 E A -2.5105
188 K A -3.1721
189 H A -2.7545
190 K A -2.8649
191 V A -1.5504
192 Y A 0.0000
193 A A -0.9939
194 C A 0.0000
195 E A -1.1545
196 V A 0.0000
197 T A -1.2487
198 H A 0.0000
199 Q A -1.8056
200 G A -0.4588
201 L A -0.2001
202 S A -0.4556
203 S A -0.3569
204 P A -0.5749
205 V A -0.0243
206 T A -0.5844
207 K A -0.9134
208 S A -0.8214
209 F A 0.0000
210 N A -2.2174
211 R A -2.3196
212 G A -1.9055
213 E A -2.3598
214 C A -1.8509
215 Q B -1.6064
216 V B -0.7808
217 Q B -1.7807
218 L B 0.0000
219 Q B -1.8328
220 E B 0.0000
221 S B -0.7436
222 G B -0.4578
223 P B 0.0000
224 G B -0.0717
225 L B -0.1887
226 V B 0.0000
227 R B -2.0559
228 P B -1.2964
229 S B -1.1332
230 Q B -1.1318
231 T B -1.0100
232 L B -0.6625
233 S B -0.7428
234 L B 0.0000
235 T B -0.6158
236 C B 0.0000
237 T B -1.0612
238 V B 0.0000
239 S B -1.3626
240 G B -0.9528
241 Y B -0.2512
242 S B -0.2592
243 I B 0.0000
244 T B -0.7623
245 S B -0.5793
246 D B -1.0709
247 H B 0.0000
248 A B 0.0000
249 W B 0.0000
250 S B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B -0.6773
254 Q B -1.0859
255 P B -1.0732
256 P B -1.1386
257 G B -1.5596
258 R B -2.6567
259 G B -1.8820
260 L B -1.2421
261 E B -1.5677
262 W B 0.0000
263 I B 0.0000
264 G B 0.0000
265 Y B 0.5934
266 I B 0.0000
267 S B 0.4355
268 Y B 0.2397
269 S B 0.3071
270 G B 0.8092
271 I B 1.9879
272 T B 1.0801
273 T B 0.4251
274 Y B -0.3346
275 N B -0.8372
276 P B -1.1567
277 S B -1.0826
278 L B 0.0000
279 K B -2.2258
280 S B -1.5224
281 R B -1.9159
282 V B 0.0000
283 T B -0.9554
284 M B 0.0000
285 L B -0.1259
286 R B -0.7342
287 D B -1.4560
288 T B -1.2057
289 S B -1.4728
290 K B -2.3396
291 N B -1.7144
292 Q B -1.4296
293 F B 0.0000
294 S B -0.4667
295 L B 0.0000
296 R B -1.5674
297 L B 0.0000
298 S B -1.0781
299 S B -0.8744
300 V B 0.0000
301 T B -0.5530
302 A B -0.3544
303 A B 0.0119
304 D B 0.0000
305 T B 0.1094
306 A B 0.0000
307 V B 0.2752
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 R B 0.0000
313 S B 0.0000
314 L B 0.5345
315 A B -0.5224
316 R B -1.7246
317 T B -0.6714
318 T B -0.5686
319 A B -0.0262
320 M B 0.0000
321 D B 0.0000
322 Y B 0.1023
323 W B 0.0000
324 G B 0.0000
325 Q B -2.0550
326 G B -1.0098
327 S B -0.2577
328 L B 0.5090
329 V B 0.0000
330 T B -0.1050
331 V B 0.0000
332 S B -0.7535
333 S B -0.9386
334 A B -0.7840
335 S B -1.0332
336 T B -1.1954
337 K B -2.1380
338 G B -1.7933
339 P B -0.9058
340 S B -0.6661
341 V B 0.0000
342 F B 0.0000
343 P B -1.3714
344 L B 0.0000
345 A B -0.9450
346 P B -0.7873
347 S B -1.2801
348 S B -1.3762
349 K B -1.8698
350 S B -1.4105
351 T B -0.9554
352 S B -0.9393
353 G B -0.7834
354 G B -0.7259
355 T B -0.5424
356 A B 0.0000
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.4287
364 D B -0.8132
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.7744
369 P B -0.8014
370 V B -0.7065
371 T B -0.5526
372 V B -0.0988
373 S B -0.2669
374 W B 0.0000
375 N B -0.6787
376 S B -0.5922
377 G B -0.3321
378 A B -0.1268
379 L B 0.1472
380 T B -0.0513
381 S B -0.0789
382 G B 0.0075
383 V B 0.3813
384 H B -0.0630
385 T B 0.0543
386 F B 0.0000
387 P B -0.2920
388 A B 0.3288
389 V B 0.6061
390 L B 1.2125
391 Q B -0.2334
392 S B -0.2525
393 S B -0.4199
394 G B 0.0000
395 L B -0.1303
396 Y B 0.0000
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0402
404 V B 0.0000
405 P B -0.6027
406 S B -0.6658
407 S B -0.7199
408 S B -0.8630
409 L B 0.0000
410 G B -1.2505
411 T B -0.9678
412 Q B -1.3952
413 T B -1.3393
414 Y B 0.0000
415 I B -1.3763
416 C B 0.0000
417 N B -1.4761
418 V B 0.0000
419 N B -1.9728
420 H B 0.0000
421 K B -2.7557
422 P B -1.7921
423 S B -2.0599
424 N B -2.5674
425 T B -2.1367
426 K B -2.5945
427 V B -1.7066
428 D B -2.5547
429 K B -2.0890
430 K B -2.5832
431 V B 0.0000
432 E B -2.8419
433 P B -2.2278
434 K B -2.7608
435 S B -1.6159
436 C B -1.3069
437 D B -1.4281
438 K B -1.5131
439 T B -1.5784
440 H B -2.2058
441 T B -1.3868
442 C B -1.2144
443 P B -0.9147
444 P B -0.8301
445 C B -0.5976
446 P B -0.7780
447 A B -0.6941
448 P B -0.8100
449 E B -1.0891
450 L B 0.3680
451 L B 0.5301
452 G B -0.1062
453 G B -0.4061
454 P B -0.6305
455 S B -0.1709
456 V B 0.0000
457 F B 1.1909
458 L B 0.9269
459 F B 1.3666
460 P B 0.0478
461 P B 0.0000
462 K B -2.1458
463 P B -1.5118
464 K B -1.4950
465 D B -1.4120
466 T B 0.0000
467 L B -0.2219
468 M B 0.6617
469 I B 1.5952
470 S B 0.0667
471 R B -1.1716
472 T B -0.6234
473 P B 0.0000
474 E B -0.7477
475 V B 0.0000
476 T B 0.8057
477 C B 0.0000
478 V B 0.0000
479 V B 0.0000
480 V B -0.3885
481 D B -1.3350
482 V B 0.0000
483 S B -1.9083
484 H B -2.1678
485 E B -2.8273
486 D B 0.0000
487 P B -2.5827
488 E B -3.3259
489 V B 0.0000
490 K B -2.7868
491 F B 0.0000
492 N B -1.8459
493 W B 0.0000
494 Y B -1.3001
495 V B -0.7571
496 D B -1.7967
497 G B -0.7293
498 V B 0.6559
499 E B -0.9390
500 V B 0.0322
501 H B -1.2886
502 N B -1.1743
503 A B -1.1438
504 K B -2.1872
505 T B -1.7065
506 K B -2.8762
507 P B -2.3330
508 R B -3.6345
509 E B -3.5619
510 E B -3.3373
511 Q B -2.4186
512 Y B -1.3065
513 N B -1.4274
514 S B -1.2431
515 T B -1.6045
516 Y B -2.3013
517 R B -2.0635
518 V B 0.0000
519 V B -1.0159
520 S B 0.0000
521 V B 0.1570
522 L B 0.0000
523 T B -0.1784
524 V B 0.4383
525 L B 0.9225
526 H B -0.0739
527 Q B -1.2025
528 D B -1.2029
529 W B 0.0000
530 L B -0.9377
531 N B -1.9711
532 G B -1.8830
533 K B -1.9308
534 E B -2.0549
535 Y B 0.0000
536 K B -2.0195
537 C B 0.0000
538 K B -2.1770
539 V B 0.0000
540 S B -1.6423
541 N B -1.9086
542 K B -2.0592
543 A B -1.2140
544 L B -0.5522
545 P B -0.4259
546 A B -0.4003
547 P B -0.6347
548 I B -0.7282
549 E B -1.9709
550 K B -1.6826
551 T B -1.2687
552 I B -0.1119
553 S B -1.4191
554 K B -1.3353
555 A B -1.2827
556 K B -2.3017
557 G B -1.9849
558 Q B -2.1263
559 P B -1.8347
560 R B -1.8762
561 E B -2.3998
562 P B 0.0000
563 Q B -1.2620
564 V B 0.0000
565 Y B 0.0000
566 T B -0.6419
567 L B -0.2342
568 P B -0.1735
569 P B 0.0000
570 S B -1.0302
571 R B -2.1322
572 D B -2.0774
573 E B 0.0000
574 L B -0.5577
575 T B -1.0751
576 K B -2.1474
577 N B -2.4989
578 Q B -2.5004
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B 0.0000
587 G B -0.7710
588 F B 0.0000
589 Y B -1.0054
590 P B 0.0000
591 S B -0.0481
592 D B -1.0728
593 I B 0.0000
594 A B -0.6626
595 V B 0.0000
596 E B -1.8215
597 W B 0.0000
598 E B -2.1393
599 S B 0.0000
600 N B -2.2507
601 G B -1.8648
602 Q B -2.3394
603 P B -2.4026
604 E B -3.0321
605 N B -2.5532
606 N B -1.8973
607 Y B -1.2878
608 K B -0.8416
609 T B -0.5002
610 T B 0.0000
611 P B 0.0285
612 P B 0.2971
613 V B 0.8845
614 L B 1.1315
615 D B -0.1727
616 S B -1.1134
617 D B -1.8285
618 G B -0.6494
619 S B 0.0000
620 F B 0.4048
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.9754
628 V B 0.0000
629 D B -2.4821
630 K B -2.4007
631 S B -2.4704
632 R B -3.2268
633 W B -2.2862
634 Q B -2.6426
635 Q B -2.7039
636 G B -1.5265
637 N B -1.5477
638 V B -0.4614
639 F B 0.0000
640 S B -1.2143
641 C B 0.0000
642 S B -0.7642
643 V B 0.0000
644 M B -0.4607
645 H B 0.0000
646 E B -0.9650
647 A B -1.5364
648 L B 0.0000
649 H B -1.6083
650 N B -1.4892
651 H B -0.8745
652 Y B 0.1374
653 T B -0.6493
654 Q B -1.0456
655 K B -1.0786
656 S B -0.2592
657 L B 0.0000
658 S B 0.3772
659 L B 1.3461
660 S B 0.4351
661 P B -0.4515
662 G B -0.7010
663 D C -0.0322
664 I C 1.8455
665 Q C 0.0000
666 M C 0.7133
667 T C 0.0000
668 Q C -0.6529
669 S C -0.7362
670 P C -0.9670
671 S C -1.0566
672 S C -1.0533
673 L C -0.4803
674 S C -0.9014
675 A C 0.0000
676 S C -0.8629
677 V C 0.2398
678 G C -0.8063
679 D C -1.9166
680 R C -2.4233
681 V C 0.0000
682 T C -0.6587
683 I C 0.0000
684 T C -0.2398
685 C C 0.0000
686 Y C 1.2079
687 L C 0.0000
688 V C 2.7913
689 L C 2.5833
690 Y C 2.4566
691 L C 0.0000
692 I C 2.6661
693 I C 1.7810
694 V C 1.5985
695 V C 0.0000
696 G C 0.0000
697 W C 0.0000
698 Y C 0.0000
699 Q C 0.0000
700 Q C -1.4129
701 K C -1.8233
702 P C -1.6731
703 G C -1.8685
704 K C -2.5918
705 A C -1.7139
706 P C 0.0000
707 K C -1.5976
708 L C 0.0000
709 L C 0.0000
710 I C 0.0000
711 Y C 0.5624
712 Y C 1.4818
713 T C 0.6242
714 S C -0.4126
715 R C -1.3330
716 L C -0.3707
717 H C -0.5055
718 S C -0.5519
719 G C -0.4326
720 V C -0.2510
721 P C -0.4135
722 S C -0.3180
723 R C -0.6749
724 F C 0.0000
725 S C -0.4994
726 G C -0.3142
727 S C -0.4821
728 G C -0.0087
729 S C 0.6030
730 G C 1.5450
731 T C 1.0880
732 D C 0.1515
733 F C 0.0000
734 T C -0.3468
735 F C 0.0000
736 T C -0.5633
737 I C 0.0000
738 S C -1.2628
739 S C -1.1179
740 L C 0.0000
741 Q C -0.7310
742 P C -1.4463
743 E C -2.0969
744 D C 0.0000
745 I C -1.1618
746 A C 0.0000
747 T C -1.1099
748 Y C 0.0000
749 Y C 0.0000
750 C C 0.0000
751 Q C 0.0000
752 Q C 0.0000
753 G C 0.0000
754 N C 0.0102
755 T C -0.3259
756 L C 0.2344
757 P C 0.0120
758 Y C 0.0000
759 T C -0.1844
760 F C 0.0000
761 G C 0.0000
762 Q C -1.6913
763 G C -1.5199
764 T C 0.0000
765 K C -2.0206
766 V C 0.0000
767 E C -1.4308
768 I C -1.1611
769 K C -1.4642
770 R C -1.7852
771 T C -0.4764
772 V C 0.5694
773 A C 0.1814
774 A C 0.0689
775 P C -0.1563
776 S C -0.2263
777 V C 0.0000
778 F C 0.1285
779 I C 0.0000
780 F C 0.0000
781 P C 0.0000
782 P C 0.0000
783 S C 0.0000
784 D C -2.5594
785 E C -2.0846
786 Q C 0.0000
787 L C -1.9931
788 K C -2.5304
789 S C -1.5424
790 G C -1.1024
791 T C -0.9080
792 A C 0.0000
793 S C 0.0000
794 V C 0.0000
795 V C 0.0000
796 C C 0.0000
797 L C 0.0000
798 L C 0.0000
799 N C 0.0000
800 N C -0.8427
801 F C 0.0000
802 Y C 0.0000
803 P C -1.8762
804 R C -3.2279
805 E C -3.3163
806 A C -2.5498
807 K C -2.5952
808 V C -1.4647
809 Q C -1.3734
810 W C 0.0000
811 K C -0.5240
812 V C -0.7494
813 D C -1.4226
814 N C -1.2603
815 A C -0.3126
816 L C 0.3902
817 Q C -1.0424
818 S C -0.8227
819 G C -1.2567
820 N C -1.9763
821 S C -1.6015
822 Q C -1.2872
823 E C -1.8528
824 S C -0.6946
825 V C -0.8313
826 T C -1.2464
827 E C -2.5558
828 Q C -2.4691
829 D C -2.7209
830 S C -2.4447
831 K C -2.5557
832 D C -2.3362
833 S C -2.4516
834 T C 0.0000
835 Y C 0.0000
836 S C 0.0000
837 L C -0.7277
838 S C 0.0000
839 S C 0.0000
840 T C 0.0000
841 L C 0.0000
842 T C -0.5212
843 L C -0.6980
844 S C -1.3916
845 K C -2.2698
846 A C -2.3748
847 D C -3.0611
848 Y C 0.0000
849 E C -3.9183
850 K C -3.7832
851 H C -3.1238
852 K C -3.0864
853 V C -1.3008
854 Y C 0.0000
855 A C -0.8541
856 C C 0.0000
857 E C -1.1538
858 V C 0.0000
859 T C -1.2346
860 H C 0.0000
861 Q C -1.7993
862 G C -0.4304
863 L C -0.0137
864 S C -0.3899
865 S C -0.3268
866 P C -0.5181
867 V C -0.0589
868 T C -0.5944
869 K C -0.8404
870 S C -0.6555
871 F C 0.0000
872 N C -1.6173
873 R C -2.1817
874 G C -1.6340
875 E C -1.4140
876 C C -0.9822
877 Q D -1.0757
878 V D -0.0672
879 Q D -1.2923
880 L D 0.0000
881 Q D -1.9324
882 E D 0.0000
883 S D -0.7543
884 G D -0.4185
885 P D -0.0281
886 G D 0.0841
887 L D 0.0318
888 V D -0.9595
889 R D -2.2101
890 P D -1.4397
891 S D -1.4300
892 Q D -1.9052
893 T D -1.4267
894 L D -0.9261
895 S D -0.9119
896 L D 0.0000
897 T D -0.7018
898 C D 0.0000
899 T D -1.1678
900 V D 0.0000
901 S D -0.7491
902 G D -0.0453
903 Y D 0.6724
904 S D -0.0165
905 I D 0.0000
906 T D -0.8977
907 S D -0.9433
908 D D -2.0665
909 H D 0.0000
910 A D 0.0000
911 W D 0.0000
912 S D 0.0000
913 W D 0.0000
914 V D 0.0000
915 R D 0.0000
916 Q D -0.9513
917 P D -1.0026
918 P D -1.1676
919 G D -1.5551
920 R D -2.6283
921 G D -1.8555
922 L D -1.1689
923 E D -1.4347
924 W D 0.0000
925 I D 0.0000
926 G D 0.0000
927 Y D 0.0000
928 I D 0.0000
929 S D 0.0000
930 Y D -0.3015
931 S D -0.0488
932 G D 0.7262
933 I D 1.8510
934 T D 1.0828
935 T D 0.4211
936 Y D -0.2066
937 N D 0.0000
938 P D -0.9922
939 S D -0.8459
940 L D 0.0000
941 K D -2.0544
942 S D -1.3502
943 R D -1.6718
944 V D 0.0000
945 T D -0.8234
946 M D 0.0000
947 L D 0.5130
948 R D -0.4068
949 D D -1.3770
950 T D -1.1942
951 S D -1.4639
952 K D -2.3812
953 N D -1.6982
954 Q D -1.3981
955 F D 0.0000
956 S D -0.3241
957 L D 0.0000
958 R D -1.8013
959 L D 0.0000
960 S D -1.2257
961 S D -0.9856
962 V D 0.0000
963 T D -0.5975
964 A D -0.3003
965 A D 0.0264
966 D D 0.0000
967 T D 0.2192
968 A D 0.0000
969 V D 0.4093
970 Y D 0.0000
971 Y D 0.0000
972 C D 0.0000
973 A D 0.0000
974 R D 0.0000
975 S D 0.0000
976 L D -0.5360
977 A D -0.7748
978 R D -2.0307
979 T D 0.0000
980 T D -0.7862
981 A D 0.0147
982 M D 0.0000
983 D D 0.0000
984 Y D -0.0887
985 W D 0.0000
986 G D 0.0000
987 Q D -2.0783
988 G D -0.8994
989 S D -0.0825
990 L D 0.9041
991 V D 0.0000
992 T D 0.0663
993 V D 0.0000
994 S D -0.6837
995 S D -0.8936
996 A D -0.7484
997 S D -1.0138
998 T D -1.1977
999 K D -2.2790
1000 G D -2.0544
1001 P D -1.1601
1002 S D -0.6344
1003 V D 0.0000
1004 F D -0.5408
1005 P D -1.1766
1006 L D 0.0000
1007 A D 0.0000
1008 P D -0.6648
1009 S D -0.9515
1010 S D -1.1471
1011 K D -1.9858
1012 S D -1.2487
1013 T D -1.0143
1014 S D -0.9357
1015 G D -0.9101
1016 G D -0.9325
1017 T D -0.6410
1018 A D -0.4280
1019 A D 0.0000
1020 L D 0.0000
1021 G D 0.0000
1022 C D 0.0000
1023 L D 0.0000
1024 V D 0.0000
1025 K D -0.6793
1026 D D -1.4365
1027 Y D 0.0000
1028 F D 0.0000
1029 P D 0.0000
1030 E D -0.4990
1031 P D -0.6257
1032 V D -0.7513
1033 T D -0.5286
1034 V D -0.3095
1035 S D -0.2831
1036 W D 0.0000
1037 N D -0.6898
1038 S D -0.5928
1039 G D -0.3865
1040 A D -0.1411
1041 L D 0.1035
1042 T D -0.0558
1043 S D -0.0805
1044 G D -0.0799
1045 V D 0.3692
1046 H D -0.1170
1047 T D 0.0765
1048 F D 0.0000
1049 P D -0.2507
1050 A D 0.2492
1051 V D 0.6865
1052 L D 1.1750
1053 Q D -0.3656
1054 S D -0.3101
1055 S D -0.5237
1056 G D -0.2174
1057 L D -0.2253
1058 Y D 0.0000
1059 S D 0.0000
1060 L D 0.0180
1061 S D 0.0000
1062 S D 0.0000
1063 V D 0.0000
1064 V D 0.0000
1065 T D -0.0754
1066 V D 0.0000
1067 P D -0.6651
1068 S D -0.7113
1069 S D -0.7587
1070 S D -0.8495
1071 L D 0.0000
1072 G D -1.2624
1073 T D -0.9663
1074 Q D -1.4311
1075 T D -1.3090
1076 Y D 0.0000
1077 I D -1.1691
1078 C D 0.0000
1079 N D -1.4962
1080 V D 0.0000
1081 N D -1.9697
1082 H D 0.0000
1083 K D -2.6988
1084 P D -1.7193
1085 S D -2.0125
1086 N D -2.5356
1087 T D -2.1563
1088 K D -2.6263
1089 V D -1.8170
1090 D D -2.5908
1091 K D -2.1609
1092 K D -2.6869
1093 V D 0.0000
1094 E D -2.5945
1095 P D -1.5484
1096 K D -1.2549
1097 S D -1.2492
1098 C D -0.9456
1099 D D -2.1518
1100 K D -2.5027
1101 T D -1.8230
1102 H D -1.6740
1103 T D -1.1139
1104 C D -0.9523
1105 P D -0.6828
1106 P D -0.4618
1107 C D -0.5887
1108 P D -0.7361
1109 A D 0.0000
1110 P D -0.8402
1111 E D -1.4418
1112 L D -0.0724
1113 L D 1.1060
1114 G D 0.0043
1115 G D -0.2514
1116 P D 0.0000
1117 S D 0.1437
1118 V D 0.0000
1119 F D 1.7178
1120 L D 0.0000
1121 F D 2.0192
1122 P D 0.4376
1123 P D 0.0000
1124 K D -1.9877
1125 P D -1.5137
1126 K D -1.3362
1127 D D -1.3525
1128 T D 0.0000
1129 L D 0.0000
1130 M D 0.5117
1131 I D 1.4839
1132 S D -0.0854
1133 R D -1.3437
1134 T D -0.6526
1135 P D 0.0000
1136 E D -0.6875
1137 V D 0.0000
1138 T D 1.0483
1139 C D 0.0000
1140 V D 0.6892
1141 V D 0.0000
1142 V D 0.0923
1143 D D -0.4610
1144 V D 0.0000
1145 S D -1.7872
1146 H D -2.3229
1147 E D -2.8785
1148 D D -2.2912
1149 P D -2.4947
1150 E D -3.1056
1151 V D 0.0000
1152 K D -2.5832
1153 F D -1.8943
1154 N D -1.4477
1155 W D 0.0000
1156 Y D -1.4814
1157 V D -1.1675
1158 D D -2.2012
1159 G D -0.9590
1160 V D 0.4182
1161 E D -1.1467
1162 V D -0.1758
1163 H D -1.3220
1164 N D -1.1960
1165 A D -1.1854
1166 K D -2.1856
1167 T D -1.6447
1168 K D -2.5919
1169 P D -2.0682
1170 R D -2.6067
1171 E D -2.2522
1172 E D -1.8472
1173 Q D -1.7520
1174 Y D -0.5809
1175 N D -0.8278
1176 S D -0.7757
1177 T D -0.9509
1178 Y D -1.2803
1179 R D -1.3632
1180 V D 0.0000
1181 V D -0.6517
1182 S D 0.0000
1183 V D 0.1202
1184 L D 0.0000
1185 T D -0.2469
1186 V D 0.0000
1187 L D 1.0371
1188 H D 0.0000
1189 Q D -1.1917
1190 D D -1.1066
1191 W D -0.9355
1192 L D -0.8579
1193 N D -1.9752
1194 G D -2.1207
1195 K D -2.3668
1196 E D -2.4830
1197 Y D 0.0000
1198 K D -2.0820
1199 C D 0.0000
1200 K D -1.7821
1201 V D 0.0000
1202 S D -1.4284
1203 N D -1.8686
1204 K D -2.1007
1205 A D -1.2881
1206 L D -0.5889
1207 P D -0.4744
1208 A D -0.3010
1209 P D -0.4338
1210 I D -0.3488
1211 E D -1.4468
1212 K D -1.4330
1213 T D -1.2989
1214 I D -0.1787
1215 S D -1.8409
1216 K D -2.0339
1217 A D -1.6415
1218 K D -2.5080
1219 G D -2.1774
1220 Q D -2.2101
1221 P D -2.3670
1222 R D -2.9639
1223 E D -2.5813
1224 P D 0.0000
1225 Q D -1.4509
1226 V D 0.0000
1227 Y D 0.0000
1228 T D 0.0000
1229 L D -0.1031
1230 P D -0.2579
1231 P D 0.0000
1232 S D -1.1970
1233 R D -2.3780
1234 D D -2.5561
1235 E D 0.0000
1236 L D -0.7051
1237 T D -1.1694
1238 K D -2.2315
1239 N D -2.5493
1240 Q D -2.5886
1241 V D 0.0000
1242 S D 0.0000
1243 L D 0.0000
1244 T D 0.0000
1245 C D 0.0000
1246 L D 0.0000
1247 V D 0.0000
1248 K D -0.6759
1249 G D -1.1445
1250 F D 0.0000
1251 Y D -1.3806
1252 P D 0.0000
1253 S D -0.1376
1254 D D -1.2717
1255 I D 0.0000
1256 A D 0.0000
1257 V D 0.0000
1258 E D -0.9976
1259 W D 0.0000
1260 E D -1.7985
1261 S D 0.0000
1262 N D -2.2078
1263 G D -1.8387
1264 Q D -2.1123
1265 P D -1.9260
1266 E D -2.2441
1267 N D -2.0347
1268 N D -1.5442
1269 Y D -0.8915
1270 K D -0.4648
1271 T D -0.2936
1272 T D 0.0000
1273 P D -0.0198
1274 P D 0.1853
1275 V D 0.6430
1276 L D 0.6818
1277 D D -0.4827
1278 S D -1.3285
1279 D D -1.9631
1280 G D -0.8158
1281 S D -0.7542
1282 F D 0.0777
1283 F D 0.0000
1284 L D 0.0000
1285 Y D 0.0000
1286 S D 0.0000
1287 K D 0.0000
1288 L D 0.0000
1289 T D -0.8912
1290 V D 0.0000
1291 D D -2.6572
1292 K D -2.6475
1293 S D -2.6001
1294 R D -3.3713
1295 W D 0.0000
1296 Q D -2.5545
1297 Q D -2.5759
1298 G D -1.3760
1299 N D -1.5138
1300 V D -0.5235
1301 F D 0.0000
1302 S D -1.1231
1303 C D 0.0000
1304 S D 0.0000
1305 V D 0.0000
1306 M D -0.4941
1307 H D 0.0000
1308 E D -1.5037
1309 A D -1.9811
1310 L D 0.0000
1311 H D -1.6443
1312 N D -1.5949
1313 H D -0.8141
1314 Y D -0.0331
1315 T D -0.7093
1316 Q D -1.1421
1317 K D -1.2186
1318 S D -0.4558
1319 L D 0.0000
1320 S D 0.3797
1321 L D 1.1083
1322 S D 0.4729
1323 P D -0.0499
1324 G D -0.4036

 

Laboratory of Theory of Biopolymers 2015