Project name: a61472a2bfc7e6d

Status: done

submitted: 2017-11-14 10:16:11, status changed: 2017-11-14 11:40:30
Settings
Chain sequence(s) A: DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKVLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKVLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QIQLQQSGPEVVKPGASVKISCKASGYTFTDYYITWVKQKPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAFMQLSSLTSEDTAVYFCLGNVVTAAALWGQGTQVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QIQLQQSGPEVVKPGASVKISCKASGYTFTDYYITWVKQKPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAFMQLSSLTSEDTAVYFCLGNVVTAAALWGQGTQVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.8433
Maximal score value
2.2648
Average score
-0.8222
Total score value
-1091.8354

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.1221
2 I A -0.0902
3 V A 0.0000
4 L A 0.2218
5 T A 0.0000
6 Q A -1.3895
7 S A -0.7903
8 P A -0.7969
9 A A -0.6580
10 S A -0.7379
11 L A -0.3406
12 A A -0.6404
13 V A 0.0000
14 S A -1.3860
15 L A -1.2654
16 G A -1.4684
17 Q A -2.2230
18 R A -2.9174
19 A A 0.0000
20 T A -1.0754
21 I A 0.0000
22 S A -1.1272
23 C A 0.0000
24 K A -1.9196
25 A A 0.0000
26 S A -1.2124
27 Q A -2.1122
28 S A -1.5486
29 V A 0.0000
30 D A -1.2053
31 F A -0.3686
32 D A -1.8681
33 G A -1.6134
34 D A -1.4866
35 S A 0.0000
36 Y A 0.2291
37 M A 0.0000
38 N A 0.0000
39 W A 0.0000
40 Y A 0.0000
41 Q A 0.0000
42 Q A -1.1942
43 K A -1.5379
44 P A -1.2585
45 G A -1.2456
46 Q A -1.7836
47 P A -1.3688
48 P A 0.0000
49 K A -1.5426
50 V A 0.0000
51 L A 0.0000
52 I A 0.0000
53 Y A 0.1476
54 A A -0.0490
55 A A -0.4426
56 S A -0.6066
57 N A -0.9749
58 L A -0.0945
59 E A -0.6409
60 S A -0.5439
61 G A -0.3900
62 I A -0.0421
63 P A -0.2224
64 A A -0.1385
65 R A -0.9868
66 F A 0.0000
67 S A -0.5606
68 G A -0.3846
69 S A -0.5038
70 G A -0.6793
71 S A -0.6775
72 G A -1.1198
73 T A -1.5404
74 D A -1.8235
75 F A 0.0000
76 T A -0.9494
77 L A 0.0000
78 N A -1.2075
79 I A 0.0000
80 H A -2.3834
81 P A -2.0146
82 V A 0.0000
83 E A -2.5026
84 E A -3.3997
85 E A -3.0244
86 D A 0.0000
87 A A -1.7596
88 A A 0.0000
89 T A -0.7803
90 Y A 0.0000
91 Y A 0.0000
92 C A 0.0000
93 Q A 0.0000
94 Q A 0.0000
95 S A -0.7675
96 N A -1.8381
97 E A -2.5183
98 D A -1.8878
99 P A -1.6905
100 W A 0.0000
101 T A -0.7703
102 F A 0.0000
103 G A 0.0000
104 G A -0.7626
105 G A -0.8651
106 T A 0.0000
107 K A -1.2574
108 L A 0.0000
109 E A -1.2374
110 I A 0.0000
111 K A -1.6330
112 R A -1.9085
113 T A -0.3448
114 V A 0.9141
115 A A 0.3163
116 A A 0.0891
117 P A -0.2915
118 S A -0.2201
119 V A 0.0000
120 F A 0.0794
121 I A 0.0000
122 F A 0.0000
123 P A -0.5199
124 P A 0.0000
125 S A -1.7052
126 D A -3.0659
127 E A -2.9033
128 Q A 0.0000
129 L A -2.1271
130 K A -3.0749
131 S A -1.7237
132 G A -1.1909
133 T A -0.7640
134 A A 0.0000
135 S A 0.0000
136 V A 0.0000
137 V A 0.0000
138 C A 0.0000
139 L A 0.0000
140 L A 0.0000
141 N A 0.0000
142 N A -0.8197
143 F A 0.0000
144 Y A 0.0000
145 P A -1.8003
146 R A -3.1603
147 E A -3.2866
148 A A -2.4860
149 K A -2.4494
150 V A -1.1825
151 Q A -0.9205
152 W A 0.0000
153 K A -0.3839
154 V A -0.5157
155 D A -1.4090
156 N A -1.1713
157 A A -0.2287
158 L A 0.4756
159 Q A -0.9039
160 S A -0.7901
161 G A -1.2888
162 N A -2.0061
163 S A -1.6195
164 Q A -1.4669
165 E A -1.8858
166 S A 0.0000
167 V A -0.6628
168 T A -1.0354
169 E A -2.2506
170 Q A -2.1750
171 D A -2.2808
172 S A -2.4996
173 K A -2.6238
174 D A -2.0383
175 S A 0.0000
176 T A 0.0000
177 Y A -1.3868
178 S A 0.0000
179 L A -0.6454
180 S A 0.0000
181 S A 0.0000
182 T A -0.7443
183 L A 0.0000
184 T A -0.5706
185 L A -0.5522
186 S A -0.9469
187 K A -1.5912
188 A A -1.5112
189 D A -1.7369
190 Y A 0.0000
191 E A -2.6307
192 K A -2.9971
193 H A -2.5209
194 K A -2.6844
195 V A -1.4230
196 Y A 0.0000
197 A A -0.9307
198 C A 0.0000
199 E A -0.9703
200 V A 0.0000
201 T A -1.1273
202 H A 0.0000
203 Q A -1.7845
204 G A -0.4297
205 L A -0.1424
206 S A -0.4347
207 S A -0.3434
208 P A -0.4715
209 V A -0.0295
210 T A -0.6387
211 K A -1.1473
212 S A -0.9619
213 F A 0.0000
214 N A -2.1427
215 R A -2.4423
216 G A -1.9428
217 E A -2.4816
218 C A -1.9123
219 Q B -0.7282
220 I B 0.5739
221 Q B -1.1838
222 L B 0.0000
223 Q B -2.0985
224 Q B 0.0000
225 S B -1.3767
226 G B -1.3467
227 P B 0.0000
228 E B -2.1813
229 V B -1.0659
230 V B 0.0000
231 K B -1.7609
232 P B -1.4154
233 G B -1.0238
234 A B -0.8010
235 S B -0.9569
236 V B -1.1109
237 K B -1.9644
238 I B 0.0000
239 S B -1.1301
240 C B 0.0000
241 K B -2.1807
242 A B -1.2156
243 S B -0.8888
244 G B -0.2923
245 Y B -0.0353
246 T B -0.2631
247 F B 0.0000
248 T B -0.9925
249 D B -1.2687
250 Y B 0.1427
251 Y B 0.5429
252 I B 0.0000
253 T B 0.0000
254 W B 0.0000
255 V B 0.0000
256 K B 0.0000
257 Q B -1.4094
258 K B -1.9975
259 P B -1.2536
260 G B -1.4191
261 Q B -2.1372
262 G B -1.4982
263 L B -1.1951
264 E B -1.7967
265 W B 0.0000
266 I B 0.0000
267 G B 0.0000
268 W B 0.0000
269 I B 0.0000
270 Y B -0.5080
271 P B -0.4837
272 G B -1.0559
273 S B -0.8491
274 G B -1.3197
275 N B -1.7682
276 T B -1.1582
277 K B -1.5814
278 Y B -1.5698
279 N B -2.1078
280 E B -2.8225
281 K B -2.3834
282 F B 0.0000
283 K B -2.9651
284 G B -1.8458
285 K B -1.7168
286 A B 0.0000
287 T B -0.8078
288 L B 0.0000
289 T B -0.0578
290 V B -0.1890
291 D B -1.1160
292 T B -0.8965
293 S B -0.5995
294 S B -0.8119
295 S B -0.8655
296 T B -1.0713
297 A B 0.0000
298 F B -0.5298
299 M B 0.0000
300 Q B -1.1807
301 L B 0.0000
302 S B -0.8871
303 S B -0.6916
304 L B 0.0000
305 T B -1.2835
306 S B -1.4755
307 E B -2.1110
308 D B 0.0000
309 T B -1.1718
310 A B 0.0000
311 V B -0.8542
312 Y B 0.0000
313 F B 0.0000
314 C B 0.0000
315 L B 0.0000
316 G B 0.0000
317 N B 0.6950
318 V B 1.0022
319 V B 1.6390
320 T B 1.0256
321 A B 0.6501
322 A B 0.0000
323 A B 0.1071
324 L B 0.0893
325 W B 0.0000
326 G B 0.0000
327 Q B -1.9497
328 G B -1.2630
329 T B -1.3977
330 Q B -1.8836
331 V B 0.0000
332 T B -1.1513
333 V B 0.0000
334 S B -0.8430
335 A B -0.6459
336 A B -0.6584
337 S B -0.9179
338 T B -1.1629
339 K B -2.0419
340 G B -1.8913
341 P B -1.1379
342 S B -0.7494
343 V B 0.0000
344 F B -0.7013
345 P B -1.2436
346 L B 0.0000
347 A B -0.8959
348 P B -0.7456
349 S B -1.2550
350 S B -1.3832
351 K B -1.8504
352 S B -1.3927
353 T B -0.9547
354 S B -0.9645
355 G B -0.7728
356 G B -0.7059
357 T B -0.5354
358 A B 0.0000
359 A B 0.0190
360 L B 0.0000
361 G B 0.0000
362 C B 0.0000
363 L B 0.0000
364 V B 0.0000
365 K B -0.6884
366 D B -1.5857
367 Y B 0.0000
368 F B 0.0000
369 P B 0.0000
370 E B -0.9895
371 P B -0.9477
372 V B -0.6577
373 T B -0.5536
374 V B -0.3081
375 S B -0.3570
376 W B 0.0000
377 N B -0.9262
378 S B -0.7042
379 G B -0.4179
380 A B -0.2069
381 L B 0.0213
382 T B -0.1085
383 S B -0.1166
384 G B -0.1137
385 V B 0.3703
386 H B -0.0570
387 T B 0.1063
388 F B 0.0000
389 P B -0.2135
390 A B 0.3545
391 V B 0.4691
392 L B 0.6463
393 Q B -0.5577
394 S B -0.4711
395 S B -0.4378
396 G B -0.9228
397 L B -0.7345
398 Y B -0.2690
399 S B 0.0000
400 L B -0.0430
401 S B 0.0000
402 S B 0.0000
403 V B 0.0000
404 V B 0.0000
405 T B -0.0661
406 V B 0.0000
407 P B -0.6022
408 S B -0.6613
409 S B -0.7184
410 S B -0.8573
411 L B 0.0000
412 G B -1.2504
413 T B -0.9824
414 Q B -1.4129
415 T B -1.4280
416 Y B 0.0000
417 I B -1.5807
418 C B 0.0000
419 N B -1.4992
420 V B 0.0000
421 N B -1.9365
422 H B 0.0000
423 K B -2.7158
424 P B -1.9023
425 S B -2.0029
426 N B -2.5170
427 T B -2.1179
428 K B -2.5464
429 V B -1.6301
430 D B -2.4816
431 K B -2.0557
432 K B -2.7144
433 V B 0.0000
434 E B -2.8451
435 P B -2.0947
436 K B -2.6099
437 S B -1.6913
438 C B -1.6285
439 D B -1.8732
440 K B 0.0000
441 T B -1.6927
442 H B -1.8850
443 T B -1.2958
444 C B 0.0000
445 P B -0.9690
446 P B -0.9235
447 C B 0.0000
448 P B -0.8914
449 A B -1.0223
450 P B -0.9038
451 E B -1.1598
452 L B 0.5354
453 L B 1.2312
454 G B 0.2106
455 G B -0.0029
456 P B -0.2288
457 S B 0.0864
458 V B 0.0000
459 F B 1.0765
460 L B 0.8830
461 F B 1.3068
462 P B -0.0489
463 P B 0.0000
464 K B -2.0750
465 P B -1.2657
466 K B -1.1547
467 D B -1.3834
468 T B 0.0000
469 L B 0.0000
470 M B 0.8758
471 I B 1.5744
472 S B 0.0263
473 R B -1.3302
474 T B -0.7747
475 P B 0.0000
476 E B -1.4553
477 V B 0.0000
478 T B 0.5817
479 C B 0.0000
480 V B 0.0000
481 V B 0.0000
482 V B -0.0389
483 D B -0.7117
484 V B 0.0000
485 S B -1.7124
486 H B -2.1492
487 E B -2.7505
488 D B 0.0000
489 P B -2.1730
490 E B -2.5496
491 V B 0.0000
492 K B -2.4278
493 F B -1.8218
494 N B -1.2418
495 W B 0.0000
496 Y B -1.2036
497 V B 0.0000
498 D B -2.0995
499 G B -0.8347
500 V B 0.6620
501 E B -0.6115
502 V B -0.0433
503 H B -1.3046
504 N B -1.3485
505 A B -1.2506
506 K B -2.3427
507 T B -1.7876
508 K B -2.8905
509 P B -2.1508
510 R B -2.9494
511 E B -2.9912
512 E B -3.0513
513 Q B -2.3680
514 Y B -0.9451
515 N B -1.2647
516 S B -1.1471
517 T B -1.3272
518 Y B -1.9501
519 R B -1.8603
520 V B 0.0000
521 V B -0.9752
522 S B 0.0000
523 V B -0.3006
524 L B 0.0000
525 T B -0.5585
526 V B 0.2471
527 L B 0.9624
528 H B 0.0000
529 Q B -0.8876
530 D B -1.0108
531 W B 0.0000
532 L B -0.7919
533 N B -1.8800
534 G B -1.9079
535 K B -1.9337
536 E B -2.2664
537 Y B 0.0000
538 K B -1.8885
539 C B 0.0000
540 K B -1.6752
541 V B 0.0000
542 S B -1.3471
543 N B -1.7347
544 K B -2.0512
545 A B -1.1967
546 L B -0.5551
547 P B -0.4306
548 A B -0.3460
549 P B -0.5133
550 I B -0.5482
551 E B -1.5726
552 K B -1.8624
553 T B -1.3620
554 I B -0.1214
555 S B -1.4357
556 K B -1.2101
557 A B -1.2226
558 K B -2.2991
559 G B -2.0953
560 Q B -2.1848
561 P B -2.2857
562 R B -2.9104
563 E B -2.8261
564 P B 0.0000
565 Q B -1.5850
566 V B 0.0000
567 Y B 0.0000
568 T B -0.7037
569 L B -0.3236
570 P B -0.2412
571 P B -0.6721
572 S B -1.3430
573 R B -2.5475
574 D B -2.5999
575 E B 0.0000
576 L B -1.0525
577 T B -1.1073
578 K B -1.8348
579 N B -2.5159
580 Q B -2.5614
581 V B 0.0000
582 S B 0.0000
583 L B 0.0000
584 T B 0.0000
585 C B 0.0000
586 L B 0.0000
587 V B 0.0000
588 K B 0.0000
589 G B -1.1061
590 F B 0.0000
591 Y B -1.2871
592 P B 0.0000
593 S B 0.0697
594 D B -0.7956
595 I B 0.0000
596 A B -0.5797
597 V B 0.0000
598 E B -1.6962
599 W B 0.0000
600 E B -2.2367
601 S B 0.0000
602 N B -2.1271
603 G B -1.9228
604 Q B -2.2995
605 P B -2.1569
606 E B -2.4037
607 N B -2.2157
608 N B -1.7050
609 Y B -1.1462
610 K B -0.6360
611 T B -0.4113
612 T B 0.0000
613 P B 0.0468
614 P B 0.3479
615 V B 0.8869
616 L B 1.2017
617 D B -0.1792
618 S B -1.1759
619 D B -1.8760
620 G B -0.6924
621 S B 0.0000
622 F B 0.3047
623 F B 0.0000
624 L B 0.0000
625 Y B 0.0000
626 S B 0.0000
627 K B 0.0000
628 L B 0.0000
629 T B -1.0713
630 V B 0.0000
631 D B -2.8990
632 K B -2.5918
633 S B -2.2022
634 R B -2.2465
635 W B -1.9286
636 Q B -2.4409
637 Q B -2.3632
638 G B -1.5218
639 N B -1.4152
640 V B -0.8080
641 F B 0.0000
642 S B -1.3499
643 C B 0.0000
644 S B -0.9235
645 V B 0.0000
646 M B -0.4001
647 H B 0.0000
648 E B -1.0216
649 A B -1.8126
650 L B 0.0000
651 H B -1.6125
652 N B -1.4977
653 H B -0.8240
654 Y B 0.0919
655 T B -0.7952
656 Q B -1.3077
657 K B -1.3101
658 S B -0.8208
659 L B 0.0000
660 S B -0.5834
661 L B 0.0000
662 S B -0.9631
663 P B -0.9733
664 G B -0.8342
665 D C -1.7755
666 I C 0.7455
667 V C 0.0000
668 L C 0.7245
669 T C 0.0000
670 Q C -1.4929
671 S C -0.8367
672 P C -0.7987
673 A C -0.7444
674 S C -0.8842
675 L C -0.5633
676 A C -0.7614
677 V C 0.0000
678 S C -1.5175
679 L C -1.3294
680 G C -1.5149
681 Q C -2.4231
682 R C -2.8981
683 A C 0.0000
684 T C -1.0219
685 I C 0.0000
686 S C -1.0797
687 C C 0.0000
688 K C -1.9019
689 A C 0.0000
690 S C -1.0330
691 Q C -2.0342
692 S C -1.4984
693 V C 0.0000
694 D C -1.1310
695 F C -0.2898
696 D C -1.5957
697 G C -1.1379
698 D C -0.9304
699 S C 0.0000
700 Y C 0.3399
701 M C 0.0000
702 N C 0.0000
703 W C 0.0000
704 Y C 0.0000
705 Q C 0.0000
706 Q C -1.1911
707 K C -1.4952
708 P C -1.4662
709 G C -1.5958
710 Q C -2.0747
711 P C -1.4709
712 P C 0.0000
713 K C -1.1735
714 V C 0.0000
715 L C 0.0000
716 I C 0.0000
717 Y C 0.1533
718 A C -0.1415
719 A C -0.4507
720 S C -0.5662
721 N C -1.1196
722 L C -0.1689
723 E C -0.6074
724 S C -0.5787
725 G C -0.4717
726 I C -0.0806
727 P C -0.3486
728 A C -0.1081
729 R C -0.7957
730 F C 0.0000
731 S C -0.4663
732 G C -0.3805
733 S C -0.8082
734 G C -0.8485
735 S C -0.9280
736 G C -1.1439
737 T C -1.8629
738 D C -2.2270
739 F C 0.0000
740 T C -0.9425
741 L C 0.0000
742 N C -1.0005
743 I C 0.0000
744 H C -2.0140
745 P C -1.8723
746 V C 0.0000
747 E C -2.0794
748 E C -3.2039
749 E C -2.7389
750 D C 0.0000
751 A C -1.6561
752 A C 0.0000
753 T C -0.8290
754 Y C 0.0000
755 Y C 0.0000
756 C C 0.0000
757 Q C 0.0000
758 Q C 0.0000
759 S C -0.6753
760 N C -1.5393
761 E C -2.6292
762 D C -2.3033
763 P C -1.8002
764 W C -1.1080
765 T C -0.4334
766 F C 0.0000
767 G C 0.0000
768 G C -0.5537
769 G C -0.8034
770 T C 0.0000
771 K C -1.3991
772 L C 0.0000
773 E C -1.3080
774 I C 0.0000
775 K C -1.7418
776 R C -2.1815
777 T C -0.4108
778 V C 0.8569
779 A C 0.2664
780 A C 0.1124
781 P C -0.1647
782 S C -0.1774
783 V C 0.1198
784 F C 0.3493
785 I C 0.0000
786 F C 0.0000
787 P C 0.0000
788 P C 0.0000
789 S C -1.9020
790 D C -3.0870
791 E C -3.1682
792 Q C 0.0000
793 L C -2.3079
794 K C -2.8448
795 S C -1.7864
796 G C -1.2779
797 T C -0.9198
798 A C 0.0000
799 S C 0.0000
800 V C 0.0000
801 V C 0.0000
802 C C 0.0000
803 L C 0.0000
804 L C 0.0000
805 N C 0.0000
806 N C -1.1560
807 F C 0.0000
808 Y C 0.0000
809 P C -1.8638
810 R C -3.2549
811 E C -3.3175
812 A C -2.5363
813 K C -2.5003
814 V C -1.2630
815 Q C -0.9847
816 W C 0.0000
817 K C -0.6541
818 V C -0.8682
819 D C -1.5287
820 N C -1.3208
821 A C -0.3553
822 L C 0.3877
823 Q C -0.9928
824 S C -0.8106
825 G C -1.2517
826 N C -1.9272
827 S C -1.5156
828 Q C 0.0000
829 E C -1.8316
830 S C -0.7142
831 V C -0.8983
832 T C -1.2360
833 E C -2.4317
834 Q C -2.5176
835 D C -2.9752
836 S C -3.0343
837 K C -3.2924
838 D C -3.3550
839 S C 0.0000
840 T C -2.2187
841 Y C 0.0000
842 S C 0.0000
843 L C 0.0000
844 S C 0.0000
845 S C 0.0000
846 T C 0.0000
847 L C 0.0000
848 T C -0.5308
849 L C -0.7255
850 S C -1.3762
851 K C -2.3386
852 A C -2.3341
853 D C -2.9184
854 Y C 0.0000
855 E C -3.8433
856 K C -3.7097
857 H C -3.0297
858 K C -3.0412
859 V C -1.4036
860 Y C 0.0000
861 A C 0.0000
862 C C 0.0000
863 E C -0.9485
864 V C 0.0000
865 T C -1.1023
866 H C 0.0000
867 Q C -1.7610
868 G C -0.4023
869 L C -0.0795
870 S C -0.3992
871 S C -0.2814
872 P C -0.3945
873 V C 0.2264
874 T C -0.2464
875 K C -0.4610
876 S C -0.4954
877 F C 0.0000
878 N C -1.7627
879 R C -1.9320
880 G C -1.6505
881 E C -1.4376
882 C C -0.6084
883 Q D -0.7928
884 I D 0.4408
885 Q D -1.2392
886 L D 0.0000
887 Q D -2.1595
888 Q D -1.4929
889 S D -1.4670
890 G D -1.3003
891 P D 0.0000
892 E D -1.7818
893 V D -0.8600
894 V D -0.9050
895 K D -1.7042
896 P D -1.3646
897 G D -0.9881
898 A D -0.7562
899 S D -0.9616
900 V D -0.9795
901 K D -1.8448
902 I D 0.0000
903 S D -1.1984
904 C D 0.0000
905 K D -2.3264
906 A D -1.2867
907 S D -0.8663
908 G D -0.1452
909 Y D -0.0648
910 T D -0.3300
911 F D 0.0000
912 T D -1.0087
913 D D -1.3121
914 Y D 0.0989
915 Y D 0.6263
916 I D 0.0000
917 T D 0.0000
918 W D 0.0000
919 V D 0.0000
920 K D 0.0000
921 Q D -1.3066
922 K D -1.7965
923 P D -1.2306
924 G D -1.3989
925 Q D -2.1016
926 G D -1.4756
927 L D -1.0859
928 E D -1.6409
929 W D 0.0000
930 I D 0.0000
931 G D 0.0000
932 W D -0.2125
933 I D 0.0000
934 Y D -0.0814
935 P D -0.4416
936 G D -1.0120
937 S D -0.7808
938 G D -1.2784
939 N D -1.6841
940 T D -1.0200
941 K D -1.5121
942 Y D -1.6372
943 N D -2.3978
944 E D -3.4539
945 K D -3.5454
946 F D 0.0000
947 K D -3.2942
948 G D -1.9782
949 K D -1.8266
950 A D 0.0000
951 T D -0.7799
952 L D 0.0000
953 T D -0.0400
954 V D -0.1879
955 D D -1.0832
956 T D -0.8317
957 S D -0.5860
958 S D -0.8342
959 S D -0.9061
960 T D -1.1155
961 A D 0.0000
962 F D -0.5256
963 M D 0.0000
964 Q D -1.2696
965 L D 0.0000
966 S D -0.8993
967 S D -0.6847
968 L D 0.0000
969 T D -1.3919
970 S D -1.4385
971 E D -2.2209
972 D D 0.0000
973 T D -0.9971
974 A D 0.0000
975 V D -0.5570
976 Y D 0.0000
977 F D 0.0000
978 C D 0.0000
979 L D 0.0000
980 G D 0.0000
981 N D 0.0000
982 V D 1.1057
983 V D 1.7503
984 T D 1.0249
985 A D 0.7331
986 A D 0.0000
987 A D 0.1407
988 L D 0.3798
989 W D 0.0000
990 G D 0.0000
991 Q D -1.9519
992 G D -1.2004
993 T D -1.1059
994 Q D -1.2413
995 V D 0.0000
996 T D -0.9857
997 V D 0.0000
998 S D -0.8012
999 A D -0.6322
1000 A D -0.6078
1001 S D -0.9257
1002 T D -1.1796
1003 K D -2.2041
1004 G D -1.8217
1005 P D -0.9765
1006 S D -0.6856
1007 V D 0.0000
1008 F D -0.7895
1009 P D -1.3720
1010 L D 0.0000
1011 A D 0.0000
1012 P D 0.0000
1013 S D 0.0000
1014 S D -1.2685
1015 K D -2.0512
1016 S D -1.2704
1017 T D -0.9527
1018 S D -0.8313
1019 G D -0.7338
1020 G D -0.6469
1021 T D -0.4630
1022 A D 0.0000
1023 A D 0.0000
1024 L D 0.0000
1025 G D 0.0000
1026 C D 0.0000
1027 L D 0.0000
1028 V D 0.0000
1029 K D -0.4775
1030 D D -1.1151
1031 Y D 0.0000
1032 F D 0.0000
1033 P D 0.0000
1034 E D -1.0005
1035 P D -0.8183
1036 V D -0.3510
1037 T D -0.4119
1038 V D -0.2286
1039 S D -0.2545
1040 W D 0.0000
1041 N D -0.6842
1042 S D -0.5792
1043 G D -0.3157
1044 A D -0.0842
1045 L D 0.1679
1046 T D -0.0265
1047 S D -0.0764
1048 G D -0.0319
1049 V D 0.3536
1050 H D -0.1525
1051 T D 0.0481
1052 F D 0.0000
1053 P D -0.2870
1054 A D 0.4501
1055 V D 0.7785
1056 L D 1.3584
1057 Q D 0.0098
1058 S D -0.1425
1059 S D -0.3795
1060 G D -0.0754
1061 L D -0.0627
1062 Y D 0.1499
1063 S D 0.0000
1064 L D 0.0897
1065 S D 0.0000
1066 S D 0.0000
1067 V D 0.0000
1068 V D 0.0000
1069 T D -0.0492
1070 V D 0.0000
1071 P D -0.5038
1072 S D -0.5331
1073 S D -0.6342
1074 S D -0.7540
1075 L D -0.8867
1076 G D -1.1676
1077 T D -0.9079
1078 Q D -1.3717
1079 T D -1.3144
1080 Y D 0.0000
1081 I D -1.3493
1082 C D 0.0000
1083 N D -1.4907
1084 V D 0.0000
1085 N D -1.6755
1086 H D 0.0000
1087 K D -2.1461
1088 P D -1.6526
1089 S D -1.8092
1090 N D -2.2814
1091 T D -1.9500
1092 K D -2.4605
1093 V D -1.6707
1094 D D -2.5519
1095 K D -2.1859
1096 K D -2.7642
1097 V D 0.0000
1098 E D -2.6377
1099 P D -1.6248
1100 K D -1.5137
1101 S D -1.5245
1102 C D -1.0150
1103 D D -2.0856
1104 K D -2.5180
1105 T D -1.8720
1106 H D 0.0000
1107 T D -1.4455
1108 C D -1.4560
1109 P D -1.0380
1110 P D -0.8205
1111 C D 0.0000
1112 P D -0.7521
1113 A D -0.9860
1114 P D -0.6132
1115 E D -0.7325
1116 L D 0.3333
1117 L D 1.2877
1118 G D 0.0982
1119 G D -0.0617
1120 P D -0.1334
1121 S D 0.2266
1122 V D 0.0000
1123 F D 2.2648
1124 L D 1.7615
1125 F D 2.1738
1126 P D 0.5751
1127 P D 0.0000
1128 K D -1.9532
1129 P D -1.4218
1130 K D -1.1818
1131 D D -1.3801
1132 T D 0.0000
1133 L D 0.0000
1134 M D 0.3586
1135 I D 1.4369
1136 S D -0.1118
1137 R D -1.3607
1138 T D -0.5480
1139 P D 0.0000
1140 E D -0.7751
1141 V D 0.0000
1142 T D 1.1239
1143 C D 0.0000
1144 V D 0.9308
1145 V D 0.0000
1146 V D 0.2107
1147 D D -0.2922
1148 V D 0.0000
1149 S D -1.4230
1150 H D -2.1999
1151 E D -2.7496
1152 D D 0.0000
1153 P D -2.3565
1154 E D -2.9827
1155 V D 0.0000
1156 K D -2.6992
1157 F D 0.0000
1158 N D -1.2107
1159 W D 0.0000
1160 Y D -0.8948
1161 V D -0.7606
1162 D D -1.9437
1163 G D -0.6597
1164 V D 0.8847
1165 E D -0.2039
1166 V D 0.2766
1167 H D -1.2053
1168 N D -1.1614
1169 A D -1.1283
1170 K D -2.1534
1171 T D -1.5406
1172 K D -2.4097
1173 P D -2.2792
1174 R D -3.1117
1175 E D -2.4200
1176 E D -2.2939
1177 Q D -1.8194
1178 Y D -0.8349
1179 N D -1.0177
1180 S D -0.6984
1181 T D -0.7923
1182 Y D 0.0000
1183 R D -1.4444
1184 V D 0.0000
1185 V D -0.6410
1186 S D 0.0000
1187 V D 0.1333
1188 L D 0.0000
1189 T D -0.2982
1190 V D 0.0000
1191 L D 0.9006
1192 H D -0.2280
1193 Q D -1.4201
1194 D D -1.3036
1195 W D -1.0494
1196 L D -1.1026
1197 N D -2.1215
1198 G D -2.1180
1199 K D -2.1646
1200 E D -2.3239
1201 Y D 0.0000
1202 K D -1.8289
1203 C D 0.0000
1204 K D -1.6296
1205 V D 0.0000
1206 S D -1.3925
1207 N D -1.8141
1208 K D -2.0223
1209 A D -1.2307
1210 L D -0.5791
1211 P D -0.4818
1212 A D -0.3030
1213 P D -0.4360
1214 I D -0.4826
1215 E D -1.4299
1216 K D -1.5250
1217 T D -1.2079
1218 I D -0.1184
1219 S D -1.6230
1220 K D -1.4899
1221 A D -1.3878
1222 K D -2.3543
1223 G D -2.1072
1224 Q D -2.1747
1225 P D -2.2883
1226 R D -2.7942
1227 E D -2.8059
1228 P D 0.0000
1229 Q D -1.1068
1230 V D 0.0000
1231 Y D -0.8351
1232 T D -0.7188
1233 L D 0.0000
1234 P D -0.3498
1235 P D -0.6369
1236 S D -1.1672
1237 R D -2.2795
1238 D D -2.5270
1239 E D 0.0000
1240 L D -0.5169
1241 T D -1.2152
1242 K D -2.5579
1243 N D -2.7025
1244 Q D -2.6032
1245 V D 0.0000
1246 S D 0.0000
1247 L D 0.0000
1248 T D 0.0000
1249 C D 0.0000
1250 L D 0.0000
1251 V D 0.0000
1252 K D 0.0000
1253 G D -0.8650
1254 F D 0.0000
1255 Y D -1.3286
1256 P D 0.0000
1257 S D -0.0777
1258 D D -1.1442
1259 I D 0.0000
1260 A D -0.5806
1261 V D -0.2993
1262 E D -1.0298
1263 W D 0.0000
1264 E D -1.9676
1265 S D 0.0000
1266 N D -2.2128
1267 G D -1.8510
1268 Q D -2.2101
1269 P D -1.9976
1270 E D -2.2650
1271 N D -2.0698
1272 N D -1.6025
1273 Y D -0.9490
1274 K D -0.4884
1275 T D -0.2890
1276 T D 0.0000
1277 P D 0.0666
1278 P D 0.3326
1279 V D 0.9557
1280 L D 1.2127
1281 D D -0.1796
1282 S D -1.1860
1283 D D -1.9146
1284 G D -0.7990
1285 S D 0.0000
1286 F D 0.3695
1287 F D 0.0000
1288 L D 0.0000
1289 Y D 0.0000
1290 S D 0.0000
1291 K D 0.0000
1292 L D 0.0000
1293 T D 0.0000
1294 V D -1.3338
1295 D D -2.5980
1296 K D -2.5350
1297 S D -2.3312
1298 R D -2.9510
1299 W D -2.1762
1300 Q D -2.6115
1301 Q D -2.6526
1302 G D -1.8081
1303 N D -1.7521
1304 V D -1.0238
1305 F D 0.0000
1306 S D -1.2311
1307 C D 0.0000
1308 S D 0.0000
1309 V D 0.0000
1310 M D 0.0000
1311 H D 0.0000
1312 E D -1.3469
1313 A D -1.9565
1314 L D 0.0000
1315 H D -1.9035
1316 N D -1.8127
1317 H D -1.1305
1318 Y D -0.9290
1319 T D -1.2431
1320 Q D -1.4571
1321 K D -1.2002
1322 S D -0.7123
1323 L D 0.0000
1324 S D -0.5972
1325 L D 0.0000
1326 S D -0.8702
1327 P D -0.7620
1328 G D -1.1545

 

Laboratory of Theory of Biopolymers 2015