Project name: a71c75c88d1348b

Status: done

submitted: 2017-11-14 10:16:14, status changed: 2017-11-14 11:41:54
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCCIIWLAFVPFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCCIIWLAFVPFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGAVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVILYDGSDKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVAVAGTHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVESGGGAVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVILYDGSDKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVAVAGTHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.3193
Maximal score value
2.3092
Average score
-0.7558
Total score value
-1000.6582

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -0.2399
2 I A 1.1011
3 Q A 0.0000
4 M A 0.5073
5 T A 0.0000
6 Q A -1.1585
7 S A -0.6269
8 P A -0.7309
9 S A -0.7258
10 S A -0.5304
11 L A -0.1652
12 S A -0.4917
13 A A 0.0000
14 S A -0.7853
15 V A 0.2617
16 G A -0.7034
17 D A -1.6639
18 R A -2.2938
19 V A 0.0000
20 T A -0.6809
21 I A 0.0000
22 T A -0.7832
23 C A 0.0000
24 R A -1.5660
25 A A 0.0000
26 S A -0.8734
27 Q A -1.9931
28 G A -2.3086
29 I A 0.0000
30 R A -2.7755
31 N A -2.1260
32 D A -1.2040
33 L A 0.0000
34 G A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.4899
39 K A -2.4389
40 P A -1.9572
41 G A -1.8740
42 K A -2.7085
43 A A -1.6865
44 P A 0.0000
45 K A -0.9260
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.3627
50 A A -0.4947
51 A A -0.7691
52 S A -0.1490
53 S A 0.2441
54 L A 0.5253
55 Q A 0.0978
56 S A -0.2158
57 G A -0.5333
58 V A -0.1437
59 P A -0.4026
60 S A -0.2953
61 R A -0.6741
62 F A 0.0000
63 S A -0.1794
64 G A -0.1181
65 S A -0.6343
66 G A -1.3859
67 S A -1.7172
68 G A -2.1162
69 T A -1.8619
70 D A -1.9469
71 F A 0.0000
72 T A -0.7161
73 L A 0.0000
74 T A -0.5628
75 I A 0.0000
76 S A -1.2202
77 S A -1.0371
78 L A 0.0000
79 Q A -0.9056
80 P A -1.4991
81 E A -2.3240
82 D A 0.0000
83 F A 0.0000
84 A A 0.0000
85 T A -0.7997
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 C A 0.0000
90 I A 0.0000
91 I A 0.8679
92 W A 0.6185
93 L A 2.0527
94 A A 2.2633
95 F A 2.3092
96 V A 1.4776
97 P A 0.8050
98 F A 0.0000
99 G A 0.0000
100 G A -0.7460
101 G A -0.9032
102 T A 0.0000
103 K A -0.9738
104 V A 0.0000
105 E A 0.0000
106 I A -0.8710
107 K A -1.4604
108 R A -1.6590
109 T A -0.2895
110 V A 0.9164
111 A A 0.3108
112 A A 0.0646
113 P A -0.2916
114 S A -0.3343
115 V A 0.0000
116 F A 0.1763
117 I A 0.0000
118 F A 0.0000
119 P A -0.5212
120 P A 0.0000
121 S A -1.5409
122 D A -2.7900
123 E A -2.2947
124 Q A 0.0000
125 L A 0.0000
126 K A -2.7690
127 S A -1.6141
128 G A -1.0948
129 T A -0.7776
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -1.0690
139 F A 0.0000
140 Y A 0.0000
141 P A -1.6041
142 R A -2.6422
143 E A -3.0758
144 A A -2.3639
145 K A -2.4105
146 V A -1.2137
147 Q A -0.8789
148 W A 0.0000
149 K A -0.5843
150 V A -0.7746
151 D A -1.6475
152 N A -1.3011
153 A A -0.3391
154 L A 0.3872
155 Q A -0.9505
156 S A -0.7724
157 G A -1.2342
158 N A -1.9063
159 S A -1.4816
160 Q A 0.0000
161 E A -1.6445
162 S A 0.0000
163 V A -0.2510
164 T A -0.9055
165 E A -2.0712
166 Q A 0.0000
167 D A -2.4049
168 S A -2.3160
169 K A -2.6392
170 D A -2.6344
171 S A -2.4337
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A -0.4436
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.4580
181 L A -0.5690
182 S A -1.0099
183 K A -1.5946
184 A A -1.8342
185 D A -2.3268
186 Y A 0.0000
187 E A -2.8678
188 K A -3.1975
189 H A -2.5926
190 K A -2.5780
191 V A -1.4169
192 Y A 0.0000
193 A A -0.9250
194 C A 0.0000
195 E A -0.9349
196 V A 0.0000
197 T A -1.1209
198 H A 0.0000
199 Q A -1.7229
200 G A -0.4022
201 L A -0.0915
202 S A -0.4178
203 S A -0.3334
204 P A -0.4739
205 V A -0.0205
206 T A -0.4892
207 K A -0.8790
208 S A -0.8175
209 F A 0.0000
210 N A -2.1420
211 R A -2.4502
212 G A -1.9463
213 E A -2.6970
214 C A -2.2851
215 Q B -1.3150
216 V B -0.5321
217 Q B -0.9353
218 L B 0.0000
219 V B 0.1662
220 E B 0.0000
221 S B -0.5239
222 G B -0.8257
223 G B -0.5717
224 G B -0.1968
225 A B -0.3860
226 V B 0.0000
227 Q B -2.1492
228 P B -2.2622
229 G B -2.2936
230 R B -2.7111
231 S B -1.8543
232 L B -1.2868
233 R B -1.9847
234 L B 0.0000
235 S B -0.6194
236 C B 0.0000
237 A B -0.2943
238 A B -0.4813
239 S B -0.8310
240 G B -0.7176
241 F B -0.0270
242 T B -0.0716
243 F B 0.0000
244 S B -0.7927
245 S B -0.1528
246 Y B 0.3612
247 G B 0.0000
248 M B 0.0000
249 H B 0.3746
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -0.9436
254 A B -1.2025
255 P B -1.0607
256 G B -1.4993
257 K B -2.3733
258 G B -1.6119
259 L B 0.0000
260 E B -1.1786
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.5322
265 I B 0.0000
266 L B -0.0852
267 Y B -0.3937
268 D B -1.8619
269 G B -1.5300
270 S B -1.2748
271 D B -1.4038
272 K B -0.2150
273 F B 1.5640
274 Y B 0.2185
275 A B -0.5768
276 D B -2.3765
277 S B -2.1505
278 V B 0.0000
279 K B -2.6429
280 G B -2.0178
281 R B -2.3599
282 F B 0.0000
283 T B -1.1522
284 I B 0.0000
285 S B -0.4427
286 R B -0.9558
287 D B -1.6371
288 N B -1.6721
289 S B -1.5501
290 K B -2.3954
291 N B -1.8160
292 T B -1.0110
293 L B 0.0000
294 Y B -0.4792
295 L B 0.0000
296 Q B -1.5457
297 M B 0.0000
298 N B -1.9386
299 S B -1.8220
300 L B 0.0000
301 R B -3.1745
302 A B -2.0698
303 E B -2.4836
304 D B 0.0000
305 T B -0.8000
306 A B 0.0000
307 V B 0.3735
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 V B 1.0330
314 A B 0.8032
315 V B 0.7860
316 A B 0.6396
317 G B 0.0000
318 T B 0.0000
319 H B -0.1322
320 F B 1.0955
321 D B 0.0000
322 Y B 0.3917
323 W B 0.0000
324 G B 0.0000
325 Q B -1.4065
326 G B 0.0000
327 T B 0.0047
328 L B 0.4134
329 V B 0.0000
330 T B 0.0000
331 V B 0.0000
332 S B -1.0781
333 S B -0.7754
334 A B -0.5831
335 S B -0.7713
336 T B -0.9350
337 K B -1.4613
338 G B -1.6430
339 P B -0.9322
340 S B -0.5969
341 V B 0.0000
342 F B -0.5713
343 P B -1.1999
344 L B 0.0000
345 A B -0.9712
346 P B -0.7966
347 S B -1.3300
348 S B -1.6890
349 K B -2.0404
350 S B -1.3771
351 T B -0.9603
352 S B -0.9937
353 G B -0.7756
354 G B -0.7089
355 T B -0.5314
356 A B 0.0000
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.5706
364 D B -1.2487
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.4939
369 P B -0.6501
370 V B -0.4585
371 T B -0.5259
372 V B -0.2960
373 S B -0.3245
374 W B 0.0000
375 N B -0.8402
376 S B -0.6547
377 G B -0.3593
378 A B -0.1613
379 L B 0.0825
380 T B -0.1042
381 S B -0.1217
382 G B -0.2189
383 V B 0.2090
384 H B -0.2199
385 T B 0.0535
386 F B 0.0000
387 P B -0.1547
388 A B 0.5212
389 V B 0.7428
390 L B 0.9876
391 Q B -0.1287
392 S B -0.2036
393 S B -0.3638
394 G B 0.0000
395 L B -0.0629
396 Y B 0.0776
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0920
404 V B 0.0000
405 P B -0.5976
406 S B -0.6383
407 S B -0.7127
408 S B -0.8559
409 L B 0.0000
410 G B -1.2620
411 T B -0.9720
412 Q B -1.4375
413 T B -1.4395
414 Y B 0.0000
415 I B -1.4726
416 C B 0.0000
417 N B -1.5523
418 V B 0.0000
419 N B -1.9586
420 H B 0.0000
421 K B -2.6890
422 P B -1.6800
423 S B -1.8865
424 N B -2.5295
425 T B -2.1354
426 K B -2.6014
427 V B -1.7424
428 D B -2.6232
429 K B -2.2053
430 R B -2.8864
431 V B 0.0000
432 E B -2.9832
433 P B -2.3139
434 K B -2.9789
435 S B -2.4140
436 C B -2.3949
437 D B -2.9629
438 K B -3.1390
439 T B -1.9862
440 H B -2.1934
441 T B -1.8566
442 C B 0.0000
443 P B -1.5647
444 P B -0.8339
445 C B -0.2141
446 P B -0.5442
447 A B -0.5411
448 P B -0.5478
449 E B -1.0671
450 L B 0.9452
451 L B 1.3116
452 G B 0.1302
453 G B -0.1666
454 P B 0.0000
455 S B -0.1117
456 V B 0.0000
457 F B 0.7860
458 L B 0.0000
459 F B 1.5487
460 P B 0.0972
461 P B 0.0000
462 K B -1.9966
463 P B -1.3565
464 K B -1.1891
465 D B -1.2933
466 T B 0.0000
467 L B 0.0000
468 M B 0.5651
469 I B 1.6045
470 S B 0.0508
471 R B -1.1079
472 T B -0.5958
473 P B 0.0000
474 E B -0.9110
475 V B 0.0000
476 T B 0.6459
477 C B 0.0000
478 V B 0.0000
479 V B 0.0000
480 V B -0.4941
481 D B -1.3732
482 V B 0.0000
483 S B -2.1136
484 H B -2.3524
485 E B -2.9250
486 D B -2.6066
487 P B -2.6988
488 E B -3.3284
489 V B 0.0000
490 K B -2.5888
491 F B 0.0000
492 N B -1.3567
493 W B 0.0000
494 Y B -1.1342
495 V B -0.8827
496 D B -2.0470
497 G B -0.7431
498 V B 0.6651
499 E B -0.7016
500 V B 0.1613
501 H B -1.2123
502 N B -1.1410
503 A B -1.0714
504 K B -2.0975
505 T B 0.0000
506 K B -2.4537
507 P B -2.1167
508 R B -3.6021
509 E B -4.3193
510 E B -3.8105
511 Q B -2.9666
512 Y B -1.6659
513 N B -1.5225
514 S B -1.2406
515 T B -1.8487
516 Y B -2.7407
517 R B -2.5886
518 V B 0.0000
519 V B -1.0490
520 S B 0.0000
521 V B -0.0430
522 L B 0.0000
523 T B -0.2712
524 V B 0.4859
525 L B 1.1457
526 H B 0.1215
527 Q B -0.9123
528 D B -0.9720
529 W B 0.0000
530 L B -0.7872
531 N B -1.8943
532 G B -1.8376
533 K B -2.2085
534 E B -2.2203
535 Y B 0.0000
536 K B -1.6453
537 C B 0.0000
538 K B -1.7558
539 V B 0.0000
540 S B -1.4703
541 N B -1.8698
542 K B -2.0865
543 A B -1.2414
544 L B -0.5208
545 P B -0.3836
546 A B -0.3132
547 P B -0.4637
548 I B -0.3354
549 E B -1.6204
550 K B -1.3210
551 T B -1.1496
552 I B -0.1193
553 S B -1.6452
554 K B -1.8343
555 A B -1.4852
556 K B -2.4489
557 G B -2.1760
558 Q B -2.1866
559 P B -2.3270
560 R B -3.0295
561 E B -2.9837
562 P B 0.0000
563 Q B -1.7093
564 V B 0.0000
565 Y B 0.0000
566 T B -0.5853
567 L B -0.2068
568 P B -0.1864
569 P B 0.0000
570 S B -1.1782
571 R B -2.3907
572 E B -2.2831
573 E B 0.0000
574 M B -1.5532
575 T B -1.5575
576 K B -2.4048
577 N B -2.6369
578 Q B -2.5961
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0512
585 V B 0.0000
586 K B 0.0000
587 G B -1.1470
588 F B 0.0000
589 Y B -1.3965
590 P B 0.0000
591 S B -0.1518
592 D B -0.9036
593 I B 0.0000
594 A B -0.6181
595 V B 0.0000
596 E B -1.3984
597 W B 0.0000
598 E B -1.9427
599 S B 0.0000
600 N B -2.2086
601 G B -1.7757
602 Q B -2.2408
603 P B -2.2039
604 E B -2.6862
605 N B -2.2920
606 N B -1.6453
607 Y B -1.0781
608 K B -0.6918
609 T B -0.3796
610 T B 0.0000
611 P B 0.0271
612 P B 0.2929
613 V B 0.7673
614 L B 1.0040
615 D B 0.0000
616 S B -1.2334
617 D B -1.9172
618 G B -0.7935
619 S B -0.5339
620 F B 0.0000
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.9150
628 V B 0.0000
629 D B -2.5025
630 K B -2.8143
631 S B -2.6016
632 R B -3.3800
633 W B 0.0000
634 Q B -2.8438
635 Q B -2.7744
636 G B -1.7690
637 N B -1.8234
638 V B -0.6384
639 F B 0.0000
640 S B -1.1288
641 C B 0.0000
642 S B -0.7811
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.2986
647 A B -1.9917
648 L B 0.0000
649 H B -1.8173
650 N B -1.7239
651 H B -1.2374
652 Y B -0.6271
653 T B -1.0252
654 Q B -1.1478
655 K B -1.0263
656 S B -0.3193
657 L B 0.0000
658 S B 0.2128
659 L B 1.2809
660 S B 0.3783
661 P B -0.4768
662 G B -0.9912
663 D C -0.2969
664 I C 0.8973
665 Q C 0.0000
666 M C -0.2571
667 T C 0.0000
668 Q C -1.5005
669 S C -0.9327
670 P C -1.0097
671 S C -0.8629
672 S C -0.7825
673 L C -0.4672
674 S C -0.4829
675 A C -0.7240
676 S C -0.5921
677 V C 0.4131
678 G C -0.6877
679 D C -1.7213
680 R C -2.2507
681 V C -0.9494
682 T C -0.6816
683 I C 0.0000
684 T C -1.1621
685 C C 0.0000
686 R C -2.2456
687 A C 0.0000
688 S C -1.1607
689 Q C -2.1828
690 G C -2.4436
691 I C 0.0000
692 R C -2.7687
693 N C -2.4544
694 D C -1.1781
695 L C 0.0000
696 G C 0.0000
697 W C 0.0000
698 Y C 0.0000
699 Q C -1.1188
700 Q C -1.8142
701 K C -2.8387
702 P C -1.9755
703 G C -2.0487
704 K C -2.8548
705 A C -1.8180
706 P C 0.0000
707 K C -1.3213
708 L C 0.0000
709 L C 0.0000
710 I C 0.0000
711 Y C 0.2714
712 A C -0.5466
713 A C -0.8887
714 S C -0.2555
715 S C 0.1040
716 L C 0.3184
717 Q C -0.1955
718 S C -0.3622
719 G C -0.4613
720 V C -0.1216
721 P C -0.4350
722 S C -0.3416
723 R C -0.7223
724 F C 0.0000
725 S C -0.2212
726 G C -0.1820
727 S C -0.7899
728 G C -1.7304
729 S C -2.0374
730 G C -2.4407
731 T C -2.3465
732 D C -2.6730
733 F C 0.0000
734 T C -0.9469
735 L C 0.0000
736 T C -0.5401
737 I C 0.0000
738 S C -1.2601
739 S C -1.0251
740 L C 0.0000
741 Q C -0.7871
742 P C -1.4209
743 E C -2.2754
744 D C 0.0000
745 F C -1.1651
746 A C 0.0000
747 T C -0.9352
748 Y C 0.0000
749 Y C 0.0000
750 C C 0.0000
751 C C 0.0000
752 I C 0.0000
753 I C 0.9603
754 W C 0.8958
755 L C 2.1223
756 A C 2.2374
757 F C 2.2551
758 V C 0.0000
759 P C 0.6798
760 F C 0.0000
761 G C 0.0000
762 G C -0.9166
763 G C -0.9765
764 T C 0.0000
765 K C -1.0314
766 V C 0.0000
767 E C -0.8072
768 I C -0.7012
769 K C -1.1225
770 R C -0.7895
771 T C 0.1111
772 V C 1.1000
773 A C 0.4447
774 A C 0.1136
775 P C 0.0593
776 S C -0.2279
777 V C 0.0158
778 F C 0.2195
779 I C 0.0000
780 F C 0.0000
781 P C 0.0000
782 P C 0.0000
783 S C 0.0000
784 D C -1.9657
785 E C -1.7150
786 Q C 0.0000
787 L C -1.7666
788 K C -2.3820
789 S C -1.4955
790 G C -1.1930
791 T C -0.8591
792 A C 0.0000
793 S C 0.0000
794 V C 0.0000
795 V C 0.0000
796 C C 0.0000
797 L C 0.0000
798 L C 0.0000
799 N C 0.0000
800 N C -0.7788
801 F C 0.0000
802 Y C 0.0000
803 P C -1.2929
804 R C -2.2675
805 E C -2.8943
806 A C -2.3016
807 K C -2.4493
808 V C 0.0000
809 Q C -1.2522
810 W C 0.0000
811 K C -0.6804
812 V C -0.8447
813 D C -1.5700
814 N C -1.3165
815 A C -0.3532
816 L C 0.3471
817 Q C -1.0774
818 S C -0.8520
819 G C -1.2799
820 N C -2.0211
821 S C -1.6363
822 Q C -1.3123
823 E C -1.7345
824 S C 0.0000
825 V C -0.3119
826 T C -0.6376
827 E C -1.6234
828 Q C 0.0000
829 D C -2.0323
830 S C -2.1015
831 K C -2.3917
832 D C -1.9857
833 S C -1.9061
834 T C 0.0000
835 Y C 0.0000
836 S C 0.0000
837 L C -0.3923
838 S C 0.0000
839 S C 0.0000
840 T C 0.0000
841 L C 0.0000
842 T C -0.5582
843 L C -0.5925
844 S C -1.1748
845 K C -2.1454
846 A C -2.0690
847 D C -2.3763
848 Y C 0.0000
849 E C -3.7743
850 K C -3.5756
851 H C -3.1503
852 K C -3.3519
853 V C -1.6280
854 Y C 0.0000
855 A C -1.0436
856 C C 0.0000
857 E C -1.1423
858 V C 0.0000
859 T C -1.2021
860 H C 0.0000
861 Q C -1.7067
862 G C -0.4305
863 L C -0.1569
864 S C -0.4385
865 S C -0.3311
866 P C -0.4357
867 V C -0.0133
868 T C -0.6241
869 K C -1.0471
870 S C -0.9012
871 F C 0.0000
872 N C -2.3102
873 R C -2.6170
874 G C -1.9018
875 E C -1.5170
876 C C -0.5890
877 Q D -0.8452
878 V D -0.0042
879 Q D -0.7441
880 L D 0.0000
881 V D 0.5495
882 E D 0.0000
883 S D -0.3887
884 G D -0.8062
885 G D -0.5453
886 G D -0.1831
887 A D -0.3844
888 V D 0.0000
889 Q D -2.1994
890 P D -2.2485
891 G D -2.2575
892 R D -2.7796
893 S D -2.1108
894 L D -1.6410
895 R D -2.1603
896 L D 0.0000
897 S D -0.6069
898 C D 0.0000
899 A D -0.2208
900 A D 0.0000
901 S D -0.5480
902 G D -0.2249
903 F D 0.1257
904 T D -0.0311
905 F D 0.0000
906 S D -0.7165
907 S D -0.0011
908 Y D 0.5128
909 G D 0.0000
910 M D 0.0000
911 H D 0.0000
912 W D 0.0000
913 V D 0.0000
914 R D -0.6551
915 Q D -1.0079
916 A D -1.2331
917 P D -1.1090
918 G D -1.4700
919 K D -2.3717
920 G D -1.5741
921 L D -1.1221
922 E D -1.2827
923 W D 0.0000
924 V D 0.0000
925 A D 0.0000
926 V D 0.0000
927 I D 0.0000
928 L D -0.2515
929 Y D -0.1642
930 D D -1.7366
931 G D -1.4455
932 S D -1.1706
933 D D -1.3009
934 K D -0.5860
935 F D 1.2937
936 Y D 0.2549
937 A D -0.5853
938 D D -2.3653
939 S D -2.2088
940 V D 0.0000
941 K D -2.7482
942 G D -2.2780
943 R D -2.9941
944 F D 0.0000
945 T D -1.3565
946 I D 0.0000
947 S D -0.5842
948 R D -1.1257
949 D D -1.9454
950 N D -1.7036
951 S D -1.6312
952 K D -2.4853
953 N D -1.8723
954 T D -1.0724
955 L D 0.0000
956 Y D -0.5971
957 L D 0.0000
958 Q D -1.7002
959 M D 0.0000
960 N D -2.2652
961 S D -2.0057
962 L D 0.0000
963 R D -3.2179
964 A D -2.0536
965 E D -2.4808
966 D D 0.0000
967 T D -0.7519
968 A D 0.0000
969 V D 0.3962
970 Y D 0.0000
971 Y D 0.0000
972 C D 0.0000
973 A D 0.0000
974 K D 0.0000
975 V D 0.8613
976 A D 0.6940
977 V D 0.9752
978 A D 0.0000
979 G D 0.0000
980 T D 0.0000
981 H D 0.0000
982 F D 0.0000
983 D D -0.1327
984 Y D -0.0884
985 W D 0.0000
986 G D 0.0000
987 Q D -1.1789
988 G D 0.0000
989 T D 0.2920
990 L D 0.8362
991 V D 0.0000
992 T D -0.3000
993 V D 0.0000
994 S D -1.0927
995 S D -0.7893
996 A D -0.6667
997 S D -0.8431
998 T D -0.9706
999 K D -1.5653
1000 G D -1.5812
1001 P D -0.7380
1002 S D -0.3709
1003 V D -0.3194
1004 F D -0.3916
1005 P D -1.1113
1006 L D 0.0000
1007 A D 0.0000
1008 P D -0.6635
1009 S D -1.0588
1010 S D -1.1993
1011 K D -2.0392
1012 S D -1.2598
1013 T D -0.9746
1014 S D -0.9047
1015 G D -0.7707
1016 G D -0.6966
1017 T D -0.5342
1018 A D 0.0000
1019 A D 0.0485
1020 L D 0.0000
1021 G D 0.0000
1022 C D 0.0000
1023 L D 0.0000
1024 V D 0.0000
1025 K D -0.3331
1026 D D -0.7660
1027 Y D 0.0000
1028 F D 0.0000
1029 P D 0.0000
1030 E D -0.6316
1031 P D -0.7329
1032 V D -0.5242
1033 T D -0.5637
1034 V D -0.1521
1035 S D -0.3547
1036 W D 0.0000
1037 N D -0.8227
1038 S D -0.6942
1039 G D -0.5432
1040 A D -0.2037
1041 L D 0.0718
1042 T D -0.0813
1043 S D -0.0812
1044 G D -0.0063
1045 V D 0.3811
1046 H D -0.0334
1047 T D 0.0967
1048 F D 0.0000
1049 P D -0.0643
1050 A D 0.2911
1051 V D 0.8052
1052 L D 1.1895
1053 Q D -0.4512
1054 S D -0.3423
1055 S D -0.4208
1056 G D -0.0989
1057 L D -0.0790
1058 Y D 0.1986
1059 S D 0.0000
1060 L D 0.0000
1061 S D 0.0000
1062 S D 0.0000
1063 V D 0.0000
1064 V D 0.0000
1065 T D -0.0470
1066 V D 0.0000
1067 P D -0.5479
1068 S D -0.6301
1069 S D -0.7259
1070 S D -0.8381
1071 L D 0.0000
1072 G D -1.2266
1073 T D -0.9661
1074 Q D -1.3745
1075 T D -1.3792
1076 Y D 0.0000
1077 I D -1.5260
1078 C D 0.0000
1079 N D -1.6046
1080 V D 0.0000
1081 N D -2.0089
1082 H D 0.0000
1083 K D -2.7451
1084 P D -1.7401
1085 S D -1.9094
1086 N D -2.5602
1087 T D -2.1628
1088 K D -2.6911
1089 V D -1.8229
1090 D D -2.6860
1091 K D -2.3260
1092 R D -2.9406
1093 V D 0.0000
1094 E D -2.6401
1095 P D -1.5308
1096 K D -1.2050
1097 S D -1.1456
1098 C D -0.5012
1099 D D -1.6708
1100 K D -2.0808
1101 T D -1.6677
1102 H D -2.0780
1103 T D -1.5855
1104 C D -1.5151
1105 P D -0.7240
1106 P D -0.7250
1107 C D -0.4931
1108 P D -0.6128
1109 A D -1.0152
1110 P D -1.1215
1111 E D -1.4381
1112 L D 0.1298
1113 L D 1.3115
1114 G D 0.0429
1115 G D -0.0296
1116 P D -0.0385
1117 S D 0.3291
1118 V D 0.0000
1119 F D 2.2526
1120 L D 0.0000
1121 F D 2.0702
1122 P D 0.4991
1123 P D 0.0000
1124 K D -1.9915
1125 P D -1.4103
1126 K D -0.9877
1127 D D -1.1223
1128 T D 0.0000
1129 L D 0.0000
1130 M D 0.9112
1131 I D 1.6494
1132 S D 0.2445
1133 R D -0.7255
1134 T D -0.2469
1135 P D 0.0000
1136 E D -1.0204
1137 V D 0.0000
1138 T D 0.9500
1139 C D 0.0000
1140 V D 0.9247
1141 V D 0.0000
1142 V D 0.5857
1143 D D -0.1146
1144 V D 0.0000
1145 S D -1.7990
1146 H D -2.3967
1147 E D -2.8230
1148 D D -2.2081
1149 P D -2.1887
1150 E D -2.2768
1151 V D 0.0000
1152 K D -2.4980
1153 F D -1.8643
1154 N D -1.4448
1155 W D 0.0000
1156 Y D -0.9559
1157 V D -0.6675
1158 D D -1.7941
1159 G D -0.5871
1160 V D 0.9603
1161 E D -0.1920
1162 V D 0.1939
1163 H D -1.2510
1164 N D -1.2414
1165 A D -1.1601
1166 K D -2.3258
1167 T D -1.5016
1168 K D -2.2375
1169 P D -2.0261
1170 R D -2.4985
1171 E D -2.4710
1172 E D -2.5430
1173 Q D -2.3332
1174 Y D -1.0565
1175 N D -1.1317
1176 S D -0.9011
1177 T D -0.9247
1178 Y D 0.0000
1179 R D -1.5436
1180 V D 0.0000
1181 V D -0.4510
1182 S D 0.0000
1183 V D -0.1160
1184 L D 0.0000
1185 T D -0.3392
1186 V D 0.3540
1187 L D 1.0164
1188 H D 0.0000
1189 Q D -1.1585
1190 D D -1.4243
1191 W D -0.9757
1192 L D -1.0935
1193 N D -2.0896
1194 G D -1.9771
1195 K D -2.0329
1196 E D -2.1123
1197 Y D 0.0000
1198 K D -1.8373
1199 C D 0.0000
1200 K D -1.8388
1201 V D 0.0000
1202 S D -1.4221
1203 N D -1.7671
1204 K D -2.0825
1205 A D -1.2791
1206 L D -0.6154
1207 P D -0.5001
1208 A D -0.3862
1209 P D -0.5836
1210 I D -0.6550
1211 E D -1.7304
1212 K D -1.5158
1213 T D -1.1032
1214 I D 0.1427
1215 S D -1.4772
1216 K D -1.5392
1217 A D -1.3974
1218 K D -2.3721
1219 G D -2.1359
1220 Q D -2.1918
1221 P D -2.4002
1222 R D -3.0242
1223 E D -2.8506
1224 P D 0.0000
1225 Q D -1.2339
1226 V D 0.0000
1227 Y D -0.6191
1228 T D 0.0000
1229 L D 0.0137
1230 P D -0.2864
1231 P D -0.7362
1232 S D -1.3606
1233 R D -2.6283
1234 E D -2.8210
1235 E D 0.0000
1236 M D -1.3094
1237 T D -1.3138
1238 K D -1.9861
1239 N D -2.1917
1240 Q D -1.7468
1241 V D 0.0000
1242 S D 0.0000
1243 L D 0.0000
1244 T D 0.0000
1245 C D 0.0000
1246 L D 0.1591
1247 V D 0.0000
1248 K D 0.0000
1249 G D -1.1184
1250 F D 0.0000
1251 Y D -1.4825
1252 P D 0.0000
1253 S D -0.2075
1254 D D -1.2897
1255 I D 0.0000
1256 A D -0.5044
1257 V D 0.0000
1258 E D -0.9576
1259 W D 0.0000
1260 E D -1.8098
1261 S D 0.0000
1262 N D -1.9997
1263 G D -1.7605
1264 Q D -2.1525
1265 P D -1.8589
1266 E D -2.0213
1267 N D -2.0158
1268 N D -1.6770
1269 Y D -1.0148
1270 K D -0.7274
1271 T D -0.4092
1272 T D 0.0000
1273 P D -0.0311
1274 P D 0.2088
1275 V D 0.7253
1276 L D 0.7420
1277 D D -0.4003
1278 S D -1.2719
1279 D D -1.9486
1280 G D -0.8264
1281 S D -0.7667
1282 F D 0.1401
1283 F D 0.0000
1284 L D 0.0000
1285 Y D 0.0000
1286 S D 0.0000
1287 K D 0.0000
1288 L D 0.0000
1289 T D 0.0000
1290 V D 0.0000
1291 D D -2.0396
1292 K D -2.1504
1293 S D -1.9329
1294 R D -2.0976
1295 W D 0.0000
1296 Q D -2.4125
1297 Q D -2.3387
1298 G D -1.2536
1299 N D -1.1857
1300 V D -0.3540
1301 F D 0.0000
1302 S D -1.0894
1303 C D 0.0000
1304 S D -0.6659
1305 V D 0.0000
1306 M D 0.0000
1307 H D 0.0000
1308 E D -1.5357
1309 A D -2.0146
1310 L D 0.0000
1311 H D -1.6846
1312 N D -1.5882
1313 H D -0.7924
1314 Y D -0.0553
1315 T D -0.7864
1316 Q D -1.2016
1317 K D -1.0376
1318 S D -0.3714
1319 L D 0.0000
1320 S D 0.2563
1321 L D 1.2795
1322 S D 0.3665
1323 P D -0.2381
1324 G D -0.5278

 

Laboratory of Theory of Biopolymers 2015