Project name: a7ffd676e42c7c

Status: done

submitted: 2018-03-11 11:39:53, status changed: 2018-03-11 12:19:14
Settings
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASITDYHWNQAPGQGLEWMGADYYDSSGYWGIRVTITADESTSTAYMELSSLRSEDTAVYYCARNLGSGSYSGSRWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: DIALTQPASVSGSPGQSITISCVTSGGHSWSYQQHPGKAPKLMIYDDKGGSGSVDYYYGMDVVSNRFSGSKSGNTASLTISGLQAEDEADYYCGREDTAMVTQWFDPGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVQSGAEVKKPGSSVKVSCKASITDYHWNQAPGQGLEWMGADYYDSSGYWGIRVTITADESTSTAYMELSSLRSEDTAVYYCARNLGSGSYSGSRWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: DIALTQPASVSGSPGQSITISCVTSGGHSWSYQQHPGKAPKLMIYDDKGGSGSVDYYYGMDVVSNRFSGSKSGNTASLTISGLQAEDEADYYCGREDTAMVTQWFDPGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2809
Maximal score value
1.7346
Average score
-0.7031
Total score value
-929.492

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.2136
2 V A -0.3354
3 Q A -0.8647
4 L A 0.0214
5 V A 0.7852
6 Q A 0.1007
7 S A -0.5980
8 G A -0.5632
9 A A -0.4281
10 E A -1.4532
11 V A -0.4798
12 K A -1.8312
13 K A -2.4861
14 P A -2.3553
15 G A -1.6888
16 S A -1.2590
17 S A -1.3236
18 V A 0.0000
19 K A -2.0878
20 V A 0.0000
21 S A -0.5189
22 C A 0.0000
23 K A -0.7622
24 A A -0.0441
25 S A 0.3018
26 I A 0.7292
27 T A -0.6046
28 D A -1.1528
29 Y A -0.4783
30 H A -0.4057
31 W A 0.0000
32 N A 0.0000
33 Q A 0.0000
34 A A 0.0000
35 P A -0.9821
36 G A -1.1728
37 Q A -1.5575
38 G A -0.9332
39 L A 0.0000
40 E A -0.8872
41 W A -0.2977
42 M A 0.0000
43 G A -0.2002
44 A A -0.6640
45 D A -1.8980
46 Y A 0.0000
47 Y A -0.1400
48 D A -1.3179
49 S A -0.3571
50 S A -0.0246
51 G A 0.0691
52 Y A 1.3762
53 W A 1.2870
54 G A 0.5700
55 I A 0.7745
56 R A -0.1939
57 V A 0.0000
58 T A 0.1595
59 I A 0.6900
60 T A -0.0480
61 A A -0.8772
62 D A -2.0024
63 E A -2.1954
64 S A -1.2649
65 T A -1.1006
66 S A -1.0510
67 T A 0.0000
68 A A 0.0000
69 Y A -0.4214
70 M A 0.0000
71 E A -1.2465
72 L A 0.0000
73 S A -0.9006
74 S A -1.1783
75 L A 0.0000
76 R A -3.1859
77 S A -2.5512
78 E A -2.6587
79 D A -1.7749
80 T A -0.8746
81 A A 0.0000
82 V A 0.6447
83 Y A 0.0000
84 Y A 0.0000
85 C A 0.0000
86 A A 0.0000
87 R A 0.0000
88 N A 0.0000
89 L A -0.3835
90 G A -0.1671
91 S A -0.1832
92 G A -1.2457
93 S A -0.3632
94 Y A 0.4246
95 S A 0.0434
96 G A 0.0000
97 S A -0.2845
98 R A 0.0000
99 W A 0.0000
100 G A 0.0000
101 Q A -1.3124
102 G A 0.0000
103 T A 0.0000
104 L A 0.6004
105 V A 0.0000
106 T A 0.0000
107 V A 0.0000
108 S A -1.5210
109 S A -1.1747
110 A A -0.8289
111 S A -0.8307
112 T A -0.9866
113 K A -1.7469
114 G A -1.4883
115 P A -0.7095
116 S A -0.1875
117 V A 0.0000
118 F A -0.4138
119 P A -0.9315
120 L A 0.0000
121 A A -1.0221
122 P A 0.0000
123 S A -1.2338
124 S A -1.2098
125 K A -1.9846
126 S A -1.3581
127 T A -1.1113
128 S A -0.8912
129 G A -0.8290
130 G A -0.8588
131 T A -0.7870
132 A A -0.5955
133 A A 0.0000
134 L A 0.0000
135 G A 0.0000
136 C A 0.0000
137 L A 0.0000
138 V A 0.0000
139 K A 0.0000
140 D A -0.3756
141 Y A 0.0000
142 F A 0.0000
143 P A -0.8597
144 E A -1.1656
145 P A -0.9790
146 V A -0.7369
147 T A -0.5570
148 V A -0.0941
149 S A -0.3219
150 W A 0.0000
151 N A -0.6199
152 S A -0.5817
153 G A -0.6001
154 A A -0.2801
155 L A -0.0524
156 T A -0.2339
157 S A -0.2175
158 G A -0.2422
159 V A 0.0301
160 H A -0.2379
161 T A -0.0182
162 F A 0.0000
163 P A -0.2258
164 A A 0.0233
165 V A 0.5817
166 L A 1.0939
167 Q A 0.3764
168 S A -0.1182
169 S A -0.2077
170 G A 0.0025
171 L A -0.0463
172 Y A 0.3808
173 S A 0.0000
174 L A 0.0000
175 S A 0.0000
176 S A 0.0000
177 V A 0.0000
178 V A 0.0000
179 T A -0.1953
180 V A 0.0000
181 P A -0.5543
182 S A -0.7187
183 S A -0.5733
184 S A -0.6712
185 L A -0.8640
186 G A -1.0293
187 T A -0.7969
188 Q A -1.3224
189 T A -1.0899
190 Y A 0.0000
191 I A -0.9543
192 C A 0.0000
193 N A -1.0808
194 V A 0.0000
195 N A -1.6689
196 H A 0.0000
197 K A -2.8225
198 P A -1.8772
199 S A -2.0702
200 N A -2.6634
201 T A -2.1132
202 K A -2.3872
203 V A -1.1237
204 D A -1.4908
205 K A -1.4404
206 K A -1.9198
207 A A 0.0000
208 E A -2.7252
209 P A -1.7999
210 K A -2.1412
211 S A -1.7253
212 C A -1.6114
213 D A -3.0961
214 K A -3.4158
215 T A -2.2133
216 H A -2.5115
217 T A -1.7305
218 C A -0.5605
219 P A -0.5438
220 P A -0.0603
221 C A 0.2646
222 P A -0.5116
223 A A -0.9533
224 P A -1.1941
225 E A -1.4412
226 L A 1.2684
227 L A 1.5797
228 G A 0.3485
229 G A -0.1202
230 P A 0.0000
231 S A 0.1556
232 V A 0.0000
233 F A 1.1280
234 L A 0.8809
235 F A 0.8820
236 P A -0.3542
237 P A 0.0000
238 K A -2.2982
239 P A -1.2354
240 K A -0.9256
241 D A 0.0000
242 T A 0.0000
243 L A -0.2054
244 M A 0.4104
245 I A 1.3790
246 S A -0.0414
247 R A -1.5628
248 T A -0.9217
249 P A 0.0000
250 E A -1.8328
251 V A 0.0000
252 T A 0.2377
253 C A 0.0000
254 V A 0.0000
255 V A 0.0000
256 V A -0.6975
257 D A -1.2227
258 V A 0.0000
259 S A -1.9044
260 H A -2.6545
261 E A -3.0451
262 D A -2.3505
263 P A -2.5756
264 E A -2.9722
265 V A -1.8683
266 K A -2.1087
267 F A -1.4844
268 N A -1.8595
269 W A 0.0000
270 Y A -0.9571
271 V A -0.5103
272 D A -1.1446
273 G A -0.4121
274 V A 0.6613
275 E A -1.3494
276 V A -0.9677
277 H A -2.1334
278 N A -2.1982
279 A A -1.8200
280 K A -2.3681
281 T A -1.8462
282 K A -2.3868
283 P A -2.4359
284 R A -4.0127
285 E A -4.2809
286 E A -3.7889
287 Q A -2.2007
288 Y A 0.0784
289 N A -0.8680
290 S A -1.1735
291 T A 0.0000
292 Y A 0.0000
293 R A -3.0074
294 V A 0.0000
295 V A 0.0000
296 S A 0.0000
297 V A -0.9004
298 L A 0.0000
299 T A -0.9284
300 V A 0.0000
301 L A 0.0626
302 H A -0.5371
303 Q A -1.5103
304 D A -1.4998
305 W A 0.0000
306 L A -1.0458
307 N A -2.0925
308 G A -1.9292
309 K A -1.8624
310 E A -1.8885
311 Y A 0.0000
312 K A -1.3785
313 C A 0.0000
314 K A -1.7470
315 V A 0.0000
316 S A -1.3753
317 N A 0.0000
318 K A -2.2322
319 A A -1.5665
320 L A -0.4936
321 P A -0.4818
322 A A -0.4660
323 P A -0.7419
324 I A -0.4891
325 E A -1.6655
326 K A -1.0848
327 T A -0.7983
328 I A -0.2303
329 S A -1.0186
330 K A -1.2428
331 A A -0.9625
332 K A -2.2179
333 G A -1.8075
334 Q A -1.8838
335 P A -1.8460
336 R A -2.1368
337 E A -2.5339
338 P A 0.0000
339 Q A -1.1515
340 V A -0.7997
341 Y A 0.0000
342 T A 0.0000
343 L A 0.0000
344 P A -0.4083
345 P A -0.8981
346 S A -1.5978
347 R A -2.7760
348 D A -2.9700
349 E A 0.0000
350 L A -2.0481
351 T A -1.9767
352 K A -2.9413
353 N A -2.9299
354 Q A -2.7235
355 V A 0.0000
356 S A 0.0000
357 L A 0.0000
358 T A 0.0000
359 C A 0.0000
360 L A 0.0000
361 V A 0.0000
362 K A -0.5299
363 G A -1.0886
364 F A 0.0000
365 Y A -0.9882
366 P A 0.0000
367 S A -0.1712
368 D A -0.9027
369 I A -0.4843
370 A A -0.3344
371 V A -0.1732
372 E A -0.8474
373 W A 0.0000
374 E A -1.7346
375 S A 0.0000
376 N A -1.8937
377 G A -1.8958
378 Q A -2.3389
379 P A -1.9532
380 E A -1.8522
381 N A -2.1034
382 N A -1.6110
383 Y A -0.9841
384 K A -0.9458
385 T A -0.2989
386 T A 0.0000
387 P A -0.1356
388 P A 0.0984
389 V A 0.3615
390 L A 0.5085
391 D A -0.6372
392 S A -1.1767
393 D A -1.8671
394 G A -0.8767
395 S A 0.0000
396 F A 0.0748
397 F A 0.0000
398 L A 0.0000
399 Y A 0.0000
400 S A 0.0000
401 K A 0.0000
402 L A 0.0000
403 T A -1.0140
404 V A 0.0000
405 D A -2.8299
406 K A -2.7958
407 S A -2.3229
408 R A -2.2088
409 W A 0.0000
410 Q A -2.6302
411 Q A -2.4679
412 G A -1.6404
413 N A -0.9865
414 V A 0.4675
415 F A 0.0000
416 S A -0.6480
417 C A 0.0000
418 S A 0.0000
419 V A 0.0000
420 M A 0.0000
421 H A 0.0000
422 E A -1.1875
423 A A -1.6281
424 L A -1.5461
425 H A -1.8546
426 N A -1.7647
427 H A -1.2945
428 Y A -0.5561
429 T A -0.8172
430 Q A -1.2689
431 K A -0.8346
432 S A -0.3156
433 L A 0.0000
434 S A -0.0613
435 L A -0.5865
436 S A -0.7128
437 P A -0.9578
438 G A -1.5479
439 K A -2.5383
440 Q B -0.8365
441 V B 0.5953
442 Q B -0.5439
443 L B 0.0436
444 V B 0.5130
445 Q B -0.2208
446 S B -0.5545
447 G B -0.3754
448 A B 0.1167
449 E B -0.2084
450 V B 0.4497
451 K B -0.8504
452 K B -1.6155
453 P B -1.7927
454 G B -1.3745
455 S B -0.9950
456 S B -1.2812
457 V B 0.0000
458 K B -2.1700
459 V B 0.0000
460 S B -0.6081
461 C B 0.0000
462 K B -0.6594
463 A B 0.0755
464 S B 0.6819
465 I B 1.1662
466 T B -0.5479
467 D B -1.5676
468 Y B -0.2928
469 H B -0.3732
470 W B 0.0000
471 N B 0.0000
472 Q B -0.3121
473 A B -0.7323
474 P B -0.8884
475 G B -0.9629
476 Q B -1.4026
477 G B 0.0000
478 L B 0.0000
479 E B -1.1384
480 W B -0.5729
481 M B 0.0000
482 G B 0.0000
483 A B -0.3376
484 D B -1.5169
485 Y B -0.3389
486 Y B 0.4925
487 D B -0.4151
488 S B 0.3517
489 S B 0.3606
490 G B 0.3338
491 Y B 1.6694
492 W B 1.7346
493 G B 0.9675
494 I B 1.2090
495 R B 0.0468
496 V B 0.0000
497 T B 0.0067
498 I B 0.3795
499 T B -0.3277
500 A B -1.0533
501 D B -2.3264
502 E B -2.4270
503 S B -1.3175
504 T B -1.1515
505 S B -1.0069
506 T B 0.0000
507 A B 0.0000
508 Y B -0.5710
509 M B 0.0000
510 E B -1.5723
511 L B 0.0000
512 S B -1.0433
513 S B -0.9483
514 L B 0.0000
515 R B -2.4712
516 S B -2.0511
517 E B -2.3932
518 D B 0.0000
519 T B -0.7004
520 A B 0.0000
521 V B 0.4378
522 Y B 0.0000
523 Y B 0.0427
524 C B 0.0000
525 A B 0.0000
526 R B 0.0000
527 N B 0.2295
528 L B 0.2254
529 G B -0.3012
530 S B -0.6399
531 G B -0.4782
532 S B 0.6672
533 Y B 1.2681
534 S B 0.0000
535 G B 0.0000
536 S B 0.0000
537 R B 0.0000
538 W B 0.0000
539 G B 0.0000
540 Q B -1.1122
541 G B -0.3162
542 T B 0.0000
543 L B 0.8305
544 V B 0.0000
545 T B -0.2126
546 V B 0.0000
547 S B -1.0285
548 S B -0.9746
549 A B -0.6095
550 S B -0.5670
551 T B -0.7174
552 K B -1.1263
553 G B -1.2400
554 P B 0.0000
555 S B -0.3654
556 V B 0.0000
557 F B 0.0000
558 P B -0.9085
559 L B 0.0000
560 A B -0.9431
561 P B 0.0000
562 S B -0.4558
563 S B -0.7152
564 K B 0.0000
565 S B -0.0239
566 T B -0.2438
567 S B -0.5570
568 G B -1.0685
569 G B -1.2208
570 T B -0.6000
571 A B -0.3972
572 A B 0.0000
573 L B 0.0000
574 G B 0.0000
575 C B 0.0000
576 L B 0.0000
577 V B 0.0000
578 K B 0.0000
579 D B 0.0000
580 Y B 0.0000
581 F B 0.0000
582 P B 0.0000
583 E B -0.9404
584 P B -0.9987
585 V B -0.8690
586 T B -0.7690
587 V B -0.3124
588 S B -0.3472
589 W B 0.0000
590 N B -0.5880
591 S B -0.5738
592 G B -0.5820
593 A B -0.2641
594 L B 0.0108
595 T B -0.1618
596 S B -0.1632
597 G B -0.2385
598 V B 0.2138
599 H B 0.0000
600 T B 0.0390
601 F B 0.0000
602 P B -0.2848
603 A B 0.1370
604 V B 0.8146
605 L B 1.6853
606 Q B 0.6251
607 S B 0.0225
608 S B -0.0823
609 G B 0.1436
610 L B 0.2721
611 Y B 0.6551
612 S B 0.0000
613 L B 0.0000
614 S B 0.0000
615 S B 0.0000
616 V B 0.0000
617 V B 0.0000
618 T B -0.1439
619 V B 0.0000
620 P B -0.4523
621 S B -0.6125
622 S B -0.7321
623 S B -0.7805
624 L B -1.1800
625 G B -1.5844
626 T B -0.9473
627 Q B -1.5140
628 T B -1.2693
629 Y B 0.0000
630 I B -0.9348
631 C B 0.0000
632 N B -1.1313
633 V B 0.0000
634 N B -2.0807
635 H B 0.0000
636 K B -2.8801
637 P B -1.7594
638 S B -1.9697
639 N B -2.6103
640 T B -2.0617
641 K B -2.5041
642 V B -0.9685
643 D B -1.6419
644 K B -1.6568
645 K B -2.1534
646 A B 0.0000
647 E B -2.5897
648 P B -1.7840
649 K B -1.6352
650 S B -1.3236
651 C B -0.9207
652 D B -1.7426
653 K B -2.5924
654 T B -1.5269
655 H B -1.4014
656 T B -0.7237
657 C B -0.1282
658 P B -0.1391
659 P B -0.0849
660 C B 0.3094
661 P B -0.4801
662 A B -0.5125
663 P B -0.8157
664 E B -0.8260
665 L B 1.4664
666 L B 1.4482
667 G B 0.3664
668 G B -0.2546
669 P B 0.0000
670 S B 0.0527
671 V B 0.0000
672 F B 1.1641
673 L B 0.8585
674 F B 1.2585
675 P B -0.0121
676 P B 0.0000
677 K B -2.1990
678 P B -1.3057
679 K B -1.2933
680 D B 0.0000
681 T B 0.0000
682 L B -0.2847
683 M B 0.5601
684 I B 1.4274
685 S B -0.0105
686 R B -1.6333
687 T B -0.8528
688 P B 0.0000
689 E B -0.9162
690 V B 0.0000
691 T B 0.2757
692 C B 0.0000
693 V B 0.0000
694 V B 0.0000
695 V B -0.6784
696 D B -1.8430
697 V B 0.0000
698 S B -1.2803
699 H B -1.3536
700 E B -1.2101
701 D B 0.0000
702 P B -1.7920
703 E B -2.4974
704 V B -1.8079
705 K B -2.1259
706 F B -1.2560
707 N B -1.3806
708 W B 0.0000
709 Y B -1.1312
710 V B -1.2984
711 D B -2.4304
712 G B -1.1690
713 V B 0.3295
714 E B -1.4094
715 V B -0.9183
716 H B -2.0607
717 N B -2.2590
718 A B -1.7721
719 K B -2.5007
720 T B -1.9789
721 K B -2.6537
722 P B -2.5856
723 R B -3.6373
724 E B -3.7420
725 E B -3.3899
726 Q B -1.8581
727 Y B -0.1028
728 N B -1.2300
729 S B -1.1544
730 T B -1.8119
731 Y B -2.4656
732 R B -2.4066
733 V B 0.0000
734 V B 0.0000
735 S B 0.0000
736 V B 0.0000
737 L B 0.0000
738 T B -0.6107
739 V B 0.0000
740 L B 0.3085
741 H B -0.2870
742 Q B -1.3356
743 D B -1.2794
744 W B 0.0000
745 L B -0.7322
746 N B -2.0125
747 G B -2.0092
748 K B -2.3134
749 E B -2.9437
750 Y B 0.0000
751 K B -2.1615
752 C B 0.0000
753 K B -1.6970
754 V B 0.0000
755 S B -1.3469
756 N B 0.0000
757 K B -1.6835
758 A B -0.8308
759 L B 0.0000
760 P B -0.3963
761 A B -0.4962
762 P B -0.8665
763 I B -0.8510
764 E B -2.2014
765 K B -1.4131
766 T B -1.3285
767 I B -0.3564
768 S B -1.1526
769 K B -1.2455
770 A B -1.1295
771 K B -2.3519
772 G B -2.1387
773 Q B -2.4718
774 P B -2.4165
775 R B -3.1769
776 E B -3.2487
777 P B 0.0000
778 Q B -1.3941
779 V B 0.0000
780 Y B 0.0000
781 T B 0.0000
782 L B 0.0000
783 P B -0.3473
784 P B -0.8756
785 S B -1.5134
786 R B -2.8086
787 D B -2.8589
788 E B 0.0000
789 L B -2.0335
790 T B -1.7942
791 K B -2.6876
792 N B -2.7489
793 Q B -2.6489
794 V B 0.0000
795 S B 0.0000
796 L B 0.0000
797 T B 0.0000
798 C B 0.0000
799 L B 0.0000
800 V B 0.0000
801 K B -0.6245
802 G B -1.2932
803 F B 0.0000
804 Y B -1.4416
805 P B 0.0000
806 S B -0.2197
807 D B -0.8857
808 I B -0.4969
809 A B 0.0000
810 V B -0.4228
811 E B -1.1456
812 W B 0.0000
813 E B -1.6460
814 S B -1.2105
815 N B -1.8265
816 G B -1.8825
817 Q B -2.3137
818 P B -1.9326
819 E B -1.8211
820 N B -1.9801
821 N B -1.2913
822 Y B -0.9692
823 K B -1.0236
824 T B -0.4236
825 T B 0.0000
826 P B -0.1984
827 P B 0.0771
828 V B 0.0000
829 L B 0.7194
830 D B -0.5972
831 S B -1.2178
832 D B -1.8946
833 G B -0.8937
834 S B 0.0000
835 F B 0.0102
836 F B 0.0000
837 L B 0.0000
838 Y B 0.0000
839 S B 0.0000
840 K B 0.0000
841 L B 0.0000
842 T B -0.9605
843 V B 0.0000
844 D B -2.7418
845 K B -2.6965
846 S B -2.2961
847 R B -1.9811
848 W B 0.0000
849 Q B -2.3407
850 Q B -2.0566
851 G B -1.0836
852 N B -0.6239
853 V B 0.8443
854 F B 0.0000
855 S B -0.6645
856 C B 0.0000
857 S B 0.0000
858 V B 0.0000
859 M B -0.4393
860 H B 0.0000
861 E B -1.2542
862 A B -2.0099
863 L B 0.0000
864 H B -2.0177
865 N B -1.8840
866 H B -1.5070
867 Y B -0.4577
868 T B -0.7831
869 Q B -1.1666
870 K B -1.1352
871 S B -0.5866
872 L B 0.0000
873 S B -0.2021
874 L B -0.3874
875 S B -0.6876
876 P B -1.0592
877 G B -1.8491
878 K B -1.9584
879 D C -1.6604
880 I C -0.7522
881 A C -0.2431
882 L C 0.0000
883 T C 0.2296
884 Q C 0.0000
885 P C -0.3181
886 A C -0.5063
887 S C -0.7225
888 V C -0.3243
889 S C -0.2118
890 G C -0.2891
891 S C -0.6715
892 P C -1.3038
893 G C -1.4750
894 Q C -1.8496
895 S C -1.2272
896 I C 0.0000
897 T C -0.2695
898 I C 0.0000
899 S C -0.0177
900 C C 0.0000
901 V C 0.9525
902 T C 0.0000
903 S C -0.4550
904 G C -0.5382
905 G C 0.0348
906 H C 0.0000
907 S C 0.0000
908 W C 0.0000
909 S C 0.0000
910 Y C 0.0000
911 Q C -1.2593
912 Q C -1.5836
913 H C -1.8758
914 P C -1.3538
915 G C -1.7880
916 K C -2.7126
917 A C -1.9188
918 P C 0.0000
919 K C -1.7605
920 L C 0.0000
921 M C 0.0000
922 I C 0.0000
923 Y C -0.5655
924 D C -1.3894
925 D C -2.6804
926 K C -2.8582
927 G C -1.8911
928 G C -1.1748
929 S C -0.4801
930 G C -0.2140
931 S C 0.3823
932 V C 1.3383
933 D C 0.4339
934 Y C 1.4484
935 Y C 0.5103
936 Y C 0.1660
937 G C 0.0000
938 M C -0.5692
939 D C -1.4563
940 V C -0.3881
941 V C -0.0193
942 S C -0.7027
943 N C -1.3958
944 R C -1.2167
945 F C 0.0000
946 S C -0.7400
947 G C 0.0000
948 S C -1.2833
949 K C -1.9885
950 S C -0.9964
951 G C -0.5342
952 N C -0.8536
953 T C -0.5273
954 A C 0.0000
955 S C 0.0000
956 L C 0.0000
957 T C -0.2975
958 I C 0.0000
959 S C -1.0996
960 G C -1.3327
961 L C 0.0000
962 Q C -1.8681
963 A C -1.4725
964 E C -2.2773
965 D C 0.0000
966 E C -1.6661
967 A C -1.3756
968 D C 0.0000
969 Y C 0.0000
970 Y C 0.0000
971 C C 0.0000
972 G C 0.0000
973 R C -0.4126
974 E C -0.4784
975 D C -0.7089
976 T C -0.3575
977 A C -0.0483
978 M C -0.1574
979 V C -0.1995
980 T C -0.3402
981 Q C 0.0000
982 W C -0.2013
983 F C 0.0000
984 D C 0.0000
985 P C 0.0338
986 G C -0.1461
987 G C -0.5217
988 G C -0.6549
989 T C 0.0000
990 K C -1.8839
991 L C 0.0000
992 T C -0.4585
993 V C 0.3774
994 L C -0.1144
995 G C -1.0128
996 Q C -1.6244
997 P C -1.4601
998 K C -1.9281
999 A C -1.2007
1000 A C -0.7279
1001 P C -0.4419
1002 S C -0.2802
1003 V C 0.0000
1004 T C -0.6610
1005 L C 0.0000
1006 F C 0.0000
1007 P C -0.2254
1008 P C 0.0000
1009 S C -0.8979
1010 S C -1.3771
1011 E C -2.2730
1012 E C 0.0000
1013 L C -1.7278
1014 Q C -2.1124
1015 A C -1.5398
1016 N C -2.4021
1017 K C -1.6860
1018 A C 0.0000
1019 T C 0.0000
1020 L C 0.0000
1021 V C 0.0000
1022 C C 0.0000
1023 L C 0.0000
1024 I C 0.0000
1025 S C -0.3318
1026 D C -0.8375
1027 F C 0.0000
1028 Y C 0.0000
1029 P C -0.7960
1030 G C -0.5182
1031 A C -0.1141
1032 V C 0.1025
1033 T C 0.0362
1034 V C 0.0336
1035 A C -0.3498
1036 W C 0.0000
1037 K C -0.9821
1038 A C -1.4183
1039 D C -1.7296
1040 S C -0.9236
1041 S C -0.7052
1042 P C -0.3631
1043 V C 0.0876
1044 K C -1.2763
1045 A C -0.5020
1046 G C -0.7398
1047 V C -0.0047
1048 E C -1.3473
1049 T C 0.0000
1050 T C -0.5048
1051 T C -0.3982
1052 P C -0.7816
1053 S C -1.1773
1054 K C -1.9731
1055 Q C -2.0309
1056 S C -1.5282
1057 N C -1.5973
1058 N C -1.3416
1059 K C -1.3035
1060 Y C -0.7403
1061 A C 0.0000
1062 A C 0.0000
1063 S C 0.0000
1064 S C 0.0000
1065 Y C 0.0000
1066 L C 0.0000
1067 S C -0.2386
1068 L C -0.9460
1069 T C -1.6920
1070 P C 0.0000
1071 E C -3.1753
1072 Q C -2.8215
1073 W C 0.0000
1074 K C -3.1454
1075 S C -2.4802
1076 H C -2.5519
1077 R C -2.9402
1078 S C -1.5292
1079 Y C 0.0000
1080 S C -1.0519
1081 C C 0.0000
1082 Q C -0.8481
1083 V C 0.0000
1084 T C -0.4247
1085 H C 0.0000
1086 E C -1.7921
1087 G C -1.0841
1088 S C -0.5602
1089 T C -0.4825
1090 V C -0.5837
1091 E C -1.9937
1092 K C -1.6391
1093 T C -0.7514
1094 V C -0.6589
1095 A C -1.2342
1096 P C -1.6256
1097 T C -1.5179
1098 E C -2.1481
1099 C C -1.3077
1100 S C -1.0174
1101 D D -1.7528
1102 I D 0.0000
1103 A D -0.2392
1104 L D 0.0000
1105 T D 0.3433
1106 Q D 0.0472
1107 P D -0.1997
1108 A D -0.2203
1109 S D -0.3826
1110 V D -0.1723
1111 S D -0.4664
1112 G D 0.0000
1113 S D 0.0000
1114 P D -1.4933
1115 G D -1.4306
1116 Q D -1.6686
1117 S D -1.1095
1118 I D 0.0000
1119 T D -0.2874
1120 I D 0.0000
1121 S D 0.0596
1122 C D 0.0000
1123 V D 0.7698
1124 T D 0.0000
1125 S D -0.7195
1126 G D -0.9649
1127 G D -1.0048
1128 H D 0.0000
1129 S D 0.0000
1130 W D 0.0000
1131 S D 0.0000
1132 Y D 0.0000
1133 Q D 0.0000
1134 Q D -1.1752
1135 H D -1.7685
1136 P D -1.0813
1137 G D -1.2231
1138 K D -1.5483
1139 A D -1.3336
1140 P D 0.0000
1141 K D -1.3907
1142 L D -0.3357
1143 M D 0.0000
1144 I D 0.0000
1145 Y D 0.0587
1146 D D -0.6744
1147 D D -2.0630
1148 K D -2.4462
1149 G D -1.7616
1150 G D -1.6731
1151 S D -1.3945
1152 G D -1.0432
1153 S D -0.9623
1154 V D -1.2443
1155 D D -1.0988
1156 Y D 0.9609
1157 Y D 1.5013
1158 Y D 0.0000
1159 G D 0.3204
1160 M D -0.2621
1161 D D -0.7923
1162 V D -0.1672
1163 V D 0.0735
1164 S D -0.5397
1165 N D -1.4250
1166 R D -1.1571
1167 F D 0.0000
1168 S D -0.6807
1169 G D -0.5166
1170 S D -0.6869
1171 K D -0.8413
1172 S D -1.0210
1173 G D -1.1894
1174 N D -1.2066
1175 T D -0.5379
1176 A D 0.0000
1177 S D -0.2616
1178 L D 0.0000
1179 T D -0.4199
1180 I D 0.0000
1181 S D -1.0473
1182 G D -1.2903
1183 L D 0.0000
1184 Q D -1.9359
1185 A D -1.6152
1186 E D -2.3096
1187 D D 0.0000
1188 E D -1.5695
1189 A D 0.0000
1190 D D -0.6971
1191 Y D 0.0000
1192 Y D 0.0000
1193 C D 0.0000
1194 G D 0.0000
1195 R D -0.4163
1196 E D -0.0713
1197 D D -0.2426
1198 T D -0.0819
1199 A D -0.1935
1200 M D -0.2383
1201 V D -0.2752
1202 T D -0.2830
1203 Q D 0.0000
1204 W D 0.4714
1205 F D 0.4066
1206 D D 0.0000
1207 P D 0.0000
1208 G D 0.0000
1209 G D -0.1036
1210 G D 0.0864
1211 T D 0.0000
1212 K D -0.7657
1213 L D 0.0000
1214 T D 0.0000
1215 V D 0.0000
1216 L D 0.0000
1217 G D -1.2465
1218 Q D -1.8576
1219 P D -1.3432
1220 K D -1.4219
1221 A D 0.0000
1222 A D -0.3954
1223 P D -0.5752
1224 S D -0.4613
1225 V D 0.0000
1226 T D -0.3493
1227 L D 0.0000
1228 F D 0.0000
1229 P D -0.2548
1230 P D 0.0000
1231 S D -0.6639
1232 S D -1.2485
1233 E D -1.8915
1234 E D 0.0000
1235 L D -1.8532
1236 Q D -2.0600
1237 A D -1.6093
1238 N D -2.4924
1239 K D -1.9806
1240 A D 0.0000
1241 T D 0.0000
1242 L D 0.0000
1243 V D 0.0000
1244 C D 0.0000
1245 L D 0.0000
1246 I D 0.0000
1247 S D 0.0000
1248 D D -0.9617
1249 F D 0.0000
1250 Y D 0.0000
1251 P D -0.9063
1252 G D -0.4233
1253 A D -0.1515
1254 V D -0.0141
1255 T D -0.0696
1256 V D -0.2662
1257 A D -0.1362
1258 W D 0.0000
1259 K D -0.7320
1260 A D 0.0000
1261 D D -1.3136
1262 S D -0.7403
1263 S D -0.3777
1264 P D 0.0725
1265 V D 0.7331
1266 K D -0.5898
1267 A D -0.2534
1268 G D -0.7025
1269 V D -0.0804
1270 E D -1.4580
1271 T D -0.7346
1272 T D -0.5100
1273 T D 0.0000
1274 P D -0.5437
1275 S D -0.7440
1276 K D -1.1608
1277 Q D -1.5841
1278 S D -1.2316
1279 N D -1.2356
1280 N D 0.0000
1281 K D 0.0000
1282 Y D -0.3088
1283 A D 0.0000
1284 A D 0.0000
1285 S D 0.0000
1286 S D 0.0000
1287 Y D 0.0000
1288 L D 0.0000
1289 S D -0.2198
1290 L D -1.0127
1291 T D -1.9612
1292 P D 0.0000
1293 E D -3.2636
1294 Q D -2.9060
1295 W D -2.5378
1296 K D -3.1329
1297 S D -2.4705
1298 H D -2.3196
1299 R D -2.6026
1300 S D -1.4459
1301 Y D 0.0000
1302 S D -0.7049
1303 C D 0.0000
1304 Q D -0.7530
1305 V D 0.0000
1306 T D -0.5466
1307 H D 0.0000
1308 E D -2.1689
1309 G D -1.0135
1310 S D -0.3671
1311 T D -0.6205
1312 V D -0.4289
1313 E D -1.3023
1314 K D -1.0235
1315 T D -0.6824
1316 V D 0.0000
1317 A D -0.8147
1318 P D -1.3223
1319 T D -1.3935
1320 E D -1.7908
1321 C D -0.7203
1322 S D -0.6149

 

Laboratory of Theory of Biopolymers 2015