Project name: a948dd364a8bca7

Status: done

submitted: 2017-03-13 18:33:56, status changed: 2017-03-13 19:15:26
Settings
Chain sequence(s) A: TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4288
Maximal score value
1.8026
Average score
-0.7992
Total score value
-183.0063

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 T A -0.1255
8 P A -0.4720
9 I A -0.2814
10 F A 0.0000
11 A A -0.8955
12 P A -1.2735
13 G A -1.6495
14 E A -1.7809
15 N A -2.0562
16 C A 0.0000
17 S A -0.4653
18 P A -0.4385
19 A A -0.2057
20 W A 0.0000
21 G A -0.8854
22 A A -0.5873
23 A A 0.0000
24 P A -0.6217
25 A A -0.6863
26 A A -0.5017
27 Y A -0.5073
28 D A -0.7749
29 A A -0.3019
30 A A -0.3324
31 D A -0.7937
32 T A -0.7517
33 H A -1.0225
34 L A 0.0000
35 R A -1.2480
36 I A 0.0000
37 L A 0.2653
38 G A -0.4140
39 K A 0.0000
40 P A 0.0000
41 V A -0.2209
42 M A 0.0000
43 E A -0.7687
44 R A -0.9071
45 W A -0.0449
46 E A 0.0000
47 T A -0.4299
48 P A -0.2711
49 Y A 0.0000
50 M A 0.0000
51 H A -0.6626
52 A A -0.4263
53 L A 0.0000
54 A A 0.0000
55 A A -0.6743
56 A A 0.0000
57 A A 0.0000
58 S A 0.0000
59 S A -1.0148
60 K A -1.8965
61 G A -1.6095
62 G A -1.7207
63 R A -1.7944
64 V A 0.0000
65 L A 0.0000
66 E A 0.0000
67 V A 0.0000
68 G A -0.1262
69 F A 0.0000
70 G A -0.3265
71 M A 0.0000
72 A A -0.2087
73 I A 0.0000
74 A A 0.0000
75 A A 0.0000
76 S A -0.9063
77 K A -1.4282
78 V A 0.0000
79 Q A 0.0000
80 E A -2.1699
81 A A -1.5998
82 P A -1.3856
83 I A 0.0000
84 D A -2.6155
85 E A -1.9585
86 H A 0.0000
87 W A -0.0856
88 I A 0.0000
89 I A 0.0000
90 E A 0.0000
91 C A -1.1162
92 N A 0.0000
93 D A -2.5434
94 G A -1.6902
95 V A 0.0000
96 F A -2.3988
97 Q A -3.1972
98 R A -2.5218
99 L A 0.0000
100 R A -3.3938
101 D A -3.4288
102 W A -2.1920
103 A A -2.0727
104 P A -2.1930
105 R A -2.5372
106 Q A -1.8119
107 T A -1.6284
108 H A -2.1263
109 K A -2.4746
110 V A -1.2853
111 I A -0.2119
112 P A -0.6170
113 L A -0.5736
114 K A -2.3075
115 G A -1.5782
116 L A -1.1688
117 W A -1.4238
118 E A -2.8293
119 D A -2.7810
120 V A 0.0000
121 A A 0.0000
122 P A -1.4790
123 T A -0.9163
124 L A 0.0000
125 P A -1.2329
126 D A -2.2725
127 G A -1.6814
128 H A -1.3783
129 F A 0.0000
130 D A -1.3324
131 G A 0.0000
132 I A 0.0000
133 L A 0.0000
134 Y A 0.0000
135 D A -0.4361
136 T A -0.1145
137 Y A 0.0000
138 P A 0.0000
139 L A -0.6178
140 S A -1.6280
141 E A -2.2337
142 E A -2.5883
143 T A -1.4052
144 W A -0.8382
145 H A -0.9400
146 T A -0.6336
147 H A 0.0000
148 Q A 0.0000
149 F A -1.0646
150 N A -1.8243
151 F A 0.0000
152 I A 0.0000
153 K A -2.2888
154 N A -2.2837
155 H A 0.0000
156 A A 0.0000
157 F A -0.7484
158 R A -1.5382
159 L A 0.0000
160 L A 0.0000
161 K A -1.5084
162 P A -0.9318
163 G A -0.9893
164 G A 0.0000
165 V A 0.0000
166 L A 0.0000
167 T A 0.0000
168 Y A 0.0000
169 C A 0.0000
170 N A 0.0000
171 L A 0.0000
172 T A 0.0000
173 S A 0.0000
174 W A 0.0000
175 G A 0.0000
176 E A -2.7116
177 L A 0.0000
178 M A 0.0000
179 K A -2.7101
180 S A -2.1816
181 K A -2.5787
182 Y A -1.6867
183 S A -1.1692
184 D A -1.0516
185 I A 0.0000
186 T A -0.4715
187 I A 0.1679
188 M A 0.0000
189 F A 0.0000
190 E A -1.4269
191 E A -1.9525
192 T A -1.0572
193 Q A 0.0000
194 V A 0.0000
195 P A -1.1749
196 A A -1.1146
197 L A 0.0000
198 L A -1.4811
199 E A -2.1667
200 A A -1.7967
201 G A -1.3476
202 F A 0.0000
203 R A -3.1671
204 R A -2.8076
205 E A -3.1751
206 N A -2.5197
207 I A 0.0000
208 R A -2.1667
209 T A -1.3367
210 E A -1.5132
211 V A 0.0335
212 M A 0.2783
213 A A 0.6413
214 L A 1.0683
215 V A 1.8026
216 P A 0.0000
217 P A -0.4483
218 A A -0.8764
219 D A -2.2671
220 C A -1.6939
221 R A -2.4826
222 Y A 0.0000
223 Y A 0.0000
224 A A -0.7613
225 F A -0.2145
226 P A 0.6196
227 Q A 0.2126
228 M A 0.0000
229 I A 0.0000
230 T A 0.0000
231 P A 0.0000
232 L A -0.6930
233 V A 0.0000
234 T A -1.2968
235 K A -1.2628

 

Laboratory of Theory of Biopolymers 2015