Project name: 2rnx_a1_Valen

Status: done

submitted: 2018-10-09 15:46:06, status changed: 2018-10-09 15:54:57
Settings
Chain sequence(s) A: GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0105
Maximal score value
0.987
Average score
-1.2798
Total score value
-151.0199

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
715 G A -0.6709
716 S A -0.6794
717 H A -1.0067
718 M A -0.2487
719 S A -1.3693
720 K A -3.2490
721 E A -4.0105
722 P A -3.3171
723 R A -3.8642
724 D A -3.6410
725 P A -2.3286
726 D A -3.3621
727 Q A -3.4033
728 L A 0.0000
729 Y A -2.4233
730 S A -1.8687
731 T A -1.8978
732 L A 0.0000
733 K A -2.1028
734 S A -1.2180
735 I A 0.0000
736 L A 0.0000
737 Q A -2.0133
738 Q A -1.5058
739 V A 0.0000
740 K A -1.3638
741 S A -1.0058
742 H A 0.0000
743 Q A -0.9639
744 S A 0.0000
745 A A 0.0000
746 W A 0.0912
747 P A -0.1405
748 F A 0.0000
749 M A -0.9382
750 E A -2.2310
751 P A -1.8215
752 V A -2.0182
753 K A -3.4447
754 R A -3.1980
755 T A -2.3947
756 E A -3.0791
757 A A 0.0000
758 P A -1.3701
759 G A -1.0070
760 Y A 0.0000
761 Y A -0.3956
762 E A -1.5843
763 V A -0.6118
764 I A 0.0000
765 R A -1.1930
766 F A 0.9870
767 P A 0.1162
768 M A -0.1879
769 D A 0.0000
770 L A 0.0000
771 K A -2.5910
772 T A -1.7442
773 M A 0.0000
774 S A -2.6486
775 E A -3.0754
776 R A -2.2263
777 L A 0.0000
778 K A -3.5726
779 N A -2.9578
780 R A -3.1928
781 Y A -0.9262
782 Y A 0.0000
783 V A -0.6334
784 S A -1.0733
785 K A 0.0000
786 K A -1.5896
787 L A -0.0634
788 F A 0.0000
789 M A 0.0000
790 A A -0.7856
791 D A 0.0000
792 L A 0.0000
793 Q A -1.1021
794 R A -0.8530
795 V A 0.0000
796 F A 0.0000
797 T A -1.1108
798 N A 0.0000
799 C A 0.0000
800 K A -1.9766
801 E A -2.2250
802 Y A -1.0191
803 N A -1.3542
804 P A -1.6778
805 P A -2.1503
806 E A -2.5767
807 S A -2.0841
808 E A -2.2994
809 Y A -1.0513
810 Y A -1.8200
811 K A -2.2002
812 C A -1.2247
813 A A 0.0000
814 N A -1.3903
815 I A -0.5917
816 L A 0.0000
817 E A -1.2456
818 K A -1.3488
819 F A -0.5257
820 F A 0.0000
821 F A -0.8358
822 S A -1.2947
823 K A -1.7091
824 I A 0.0000
825 K A -3.0500
826 E A -3.1438
827 A A -2.4045
828 G A 0.0000
829 L A 0.0000
830 I A -2.0242
831 D A -3.0532
832 K A -2.6618

 

Laboratory of Theory of Biopolymers 2015