Project name: Model1aggre

Status: done

submitted: 2017-03-14 16:18:31, status changed: 2017-03-14 16:35:10
Settings
Chain sequence(s) A: TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.1819
Maximal score value
1.9804
Average score
-0.3126
Total score value
-71.8915

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 T A -0.1104
8 P A -0.1693
9 I A 0.3317
10 F A 0.2926
11 A A 0.0559
12 P A -0.2883
13 G A -0.4590
14 E A -1.2977
15 N A -1.4544
16 C A -0.1718
17 S A -0.0897
18 P A -0.2586
19 A A -0.0108
20 W A 0.0000
21 G A -0.1737
22 A A 0.0245
23 A A 0.0000
24 P A -0.2549
25 A A 0.0000
26 A A 0.0876
27 Y A -0.1821
28 D A -1.7559
29 A A -0.4489
30 A A -0.1667
31 D A -1.3092
32 T A -0.2676
33 H A -0.4731
34 L A 0.0000
35 R A -1.5447
36 I A 0.0000
37 L A 1.2495
38 G A -0.2715
39 K A -0.2908
40 P A -0.0484
41 V A 0.1874
42 M A 0.0000
43 E A -1.4884
44 R A -2.0212
45 W A -0.4941
46 E A -1.7948
47 T A -0.3017
48 P A 0.0000
49 Y A 0.0000
50 M A 0.0000
51 H A -0.6755
52 A A -0.1222
53 L A 0.0000
54 A A 0.0000
55 A A 0.0312
56 A A 0.0078
57 A A 0.0000
58 S A -0.2826
59 S A -0.5470
60 K A -1.7591
61 G A -0.4144
62 G A -0.2102
63 R A -0.6111
64 V A 0.0000
65 L A 0.0000
66 E A 0.0000
67 V A 0.0000
68 G A 0.0000
69 F A 0.1668
70 G A -0.1031
71 M A 0.0000
72 A A 0.1055
73 I A 0.5471
74 A A 0.0000
75 A A -0.0112
76 S A -0.2555
77 K A -0.8266
78 V A 0.0000
79 Q A -1.2726
80 E A -2.0428
81 A A -0.4979
82 P A -0.2534
83 I A 0.0000
84 D A -1.8813
85 E A -0.8400
86 H A 0.0000
87 W A 0.0000
88 I A 0.0000
89 I A 0.0000
90 E A 0.0000
91 C A 0.0825
92 N A 0.0000
93 D A -0.5563
94 G A -0.3037
95 V A 0.0000
96 F A -0.0325
97 Q A -1.3581
98 R A -1.3071
99 L A -0.2702
100 R A -1.7927
101 D A -1.4771
102 W A 0.1318
103 A A 0.0000
104 P A -0.6003
105 R A -1.9234
106 Q A -0.5751
107 T A -0.2888
108 H A -1.3203
109 K A -1.8428
110 V A -0.0543
111 I A 0.3840
112 P A 0.0144
113 L A -0.1159
114 K A -1.7025
115 G A -0.2532
116 L A 1.3213
117 W A 0.0000
118 E A -0.8474
119 D A -1.7263
120 V A 0.0000
121 A A 0.0000
122 P A -0.1722
123 T A -0.0502
124 L A 0.2260
125 P A -0.5000
126 D A -1.8426
127 G A -0.4808
128 H A -0.2803
129 F A 0.0000
130 D A -0.5982
131 G A 0.0000
132 I A 0.0000
133 L A 0.0000
134 Y A 0.0000
135 D A 0.0000
136 T A 0.0000
137 Y A 0.0000
138 P A 0.0000
139 L A 0.0000
140 S A -0.6179
141 E A -2.1760
142 E A -2.1761
143 T A -0.3953
144 W A 0.0000
145 H A -0.6796
146 T A -0.1793
147 H A 0.0000
148 Q A 0.0000
149 F A 0.9231
150 N A -0.2584
151 F A 0.0000
152 I A 0.0000
153 K A -1.8266
154 N A -0.8472
155 H A 0.0000
156 A A 0.0000
157 F A 1.5975
158 R A -1.4825
159 L A 0.0000
160 L A 0.0000
161 K A -1.7452
162 P A -0.6355
163 G A -0.5564
164 G A 0.0000
165 V A 0.3206
166 L A 0.0000
167 T A 0.0000
168 Y A 0.0000
169 C A 0.0000
170 N A 0.0000
171 L A 0.1702
172 T A 0.0227
173 S A 0.0000
174 W A 0.0000
175 G A 0.0000
176 E A -1.2794
177 L A 0.0469
178 M A 0.0000
179 K A -1.8535
180 S A -0.8051
181 K A -1.4900
182 Y A 0.8865
183 S A -0.0791
184 D A -0.5062
185 I A 0.0000
186 T A 0.3667
187 I A 1.9804
188 M A 0.7567
189 F A 0.0000
190 E A -0.9727
191 E A -1.9653
192 T A -0.3773
193 Q A 0.0000
194 V A 0.0459
195 P A 0.0448
196 A A 0.0000
197 L A 0.0000
198 L A 0.8132
199 E A -1.6076
200 A A -0.2677
201 G A -0.0704
202 F A -0.4047
203 R A -2.1230
204 R A -2.1819
205 E A -0.8329
206 N A -1.2391
207 I A -0.0158
208 R A -1.3519
209 T A -0.6018
210 E A -1.2870
211 V A 1.4950
212 M A 0.6196
213 A A 0.3596
214 L A 1.7784
215 V A 1.4304
216 P A 0.0000
217 P A -0.0996
218 A A -0.1598
219 D A -0.6694
220 C A 0.2344
221 R A -1.6675
222 Y A -0.0355
223 Y A 0.1873
224 A A 0.0432
225 F A 0.0000
226 P A -0.1583
227 Q A -0.2738
228 M A 0.0000
229 I A 0.0000
230 T A 0.0000
231 P A 0.0000
232 L A 0.0140
233 V A 0.0000
234 T A -0.0169
235 K A -0.2818
236 G A -0.5487

 

Laboratory of Theory of Biopolymers 2015