Project name: b38936bc4df9fe

Status: done

submitted: 2017-11-14 10:16:27, status changed: 2017-11-14 11:41:19
Settings
Chain sequence(s) A: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYLVLYLIIGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYLVLYLIIGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.3068
Maximal score value
2.4346
Average score
-0.7877
Total score value
-1044.4883

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.2628
2 I A 0.8301
3 V A 0.0000
4 L A 0.4929
5 T A 0.0000
6 Q A -1.2796
7 S A -0.7596
8 P A 0.0000
9 G A -0.9759
10 T A -0.5474
11 L A -0.2869
12 S A -0.7110
13 L A 0.0000
14 S A -2.1414
15 P A -2.3694
16 G A -2.6146
17 E A -3.1226
18 R A -3.2837
19 A A 0.0000
20 T A -0.7230
21 L A 0.0000
22 S A 0.0000
23 C A 0.0000
24 R A -1.0687
25 A A 0.0000
26 S A -0.7793
27 Q A -1.7255
28 S A -1.4703
29 V A 0.0000
30 G A -0.6988
31 S A -0.4567
32 S A 0.1142
33 Y A 0.6558
34 L A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A 0.0000
39 Q A 0.0000
40 K A -1.7428
41 P A -1.3716
42 G A -1.3334
43 Q A -1.8305
44 A A 0.0000
45 P A 0.0000
46 R A -1.3129
47 L A 0.0000
48 L A 0.0000
49 I A 0.0000
50 Y A 1.5138
51 L A 1.7370
52 V A 1.3805
53 L A 1.6572
54 Y A 2.3170
55 L A 1.6142
56 I A 1.6536
57 I A 2.2478
58 G A 0.6094
59 I A 0.3970
60 P A -0.8246
61 D A -1.9186
62 R A -1.8667
63 F A 0.0000
64 S A -0.0917
65 G A 0.0000
66 S A 0.1540
67 G A -0.3862
68 S A -0.5806
69 G A -0.9695
70 T A -1.2638
71 D A -1.2714
72 F A 0.0000
73 T A -0.4334
74 L A 0.0000
75 T A -0.7378
76 I A 0.0000
77 S A -2.5551
78 R A -3.4810
79 L A 0.0000
80 E A -2.1640
81 P A -1.9845
82 E A -2.3421
83 D A 0.0000
84 F A 0.0000
85 A A 0.0000
86 V A -0.3591
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 Q A 0.0000
91 Q A 0.0000
92 Y A 0.0000
93 G A -0.4931
94 S A -0.7734
95 S A -0.3966
96 P A -0.5431
97 W A -0.3221
98 T A -0.1721
99 F A 0.0000
100 G A 0.0000
101 Q A -1.3889
102 G A -1.1192
103 T A 0.0000
104 K A -0.7091
105 V A 0.0000
106 E A 0.0000
107 I A 0.0000
108 K A -1.7967
109 R A -2.1736
110 T A -0.4013
111 V A 0.8676
112 A A 0.3200
113 A A 0.1399
114 P A 0.0481
115 S A -0.2275
116 V A 0.0000
117 F A 0.2095
118 I A 0.0000
119 F A 0.0000
120 P A -0.4328
121 P A 0.0000
122 S A -1.6827
123 D A -2.9802
124 E A -2.6539
125 Q A 0.0000
126 L A -1.9920
127 K A -2.9413
128 S A -1.6686
129 G A -1.1506
130 T A -0.8160
131 A A 0.0000
132 S A 0.0000
133 V A 0.0000
134 V A 0.0000
135 C A 0.0000
136 L A 0.0000
137 L A 0.0000
138 N A 0.0000
139 N A -0.7872
140 F A 0.0000
141 Y A 0.0000
142 P A -1.4492
143 R A -2.3942
144 E A -2.9422
145 A A -2.3137
146 K A -2.4113
147 V A -1.2537
148 Q A -1.1135
149 W A 0.0000
150 K A -0.6202
151 V A -0.9576
152 D A -1.5936
153 N A -1.3572
154 A A -0.4851
155 L A -0.0089
156 Q A -1.1974
157 S A -0.9699
158 G A -1.3746
159 N A -1.9909
160 S A -1.6130
161 Q A -1.2457
162 E A -1.4909
163 S A -0.3861
164 V A -0.2714
165 T A -0.9099
166 E A -2.1399
167 Q A 0.0000
168 D A -2.5998
169 S A -2.4280
170 K A -2.6394
171 D A -2.5660
172 S A 0.0000
173 T A -1.7781
174 Y A 0.0000
175 S A 0.0000
176 L A 0.0000
177 S A 0.0000
178 S A 0.0000
179 T A -0.6882
180 L A 0.0000
181 T A -0.5630
182 L A -0.6665
183 S A -1.0556
184 K A -1.6428
185 A A -1.7389
186 D A -2.2885
187 Y A 0.0000
188 E A -2.5744
189 K A -3.1798
190 H A -2.6999
191 K A -2.7304
192 V A -1.2524
193 Y A 0.0000
194 A A -0.8391
195 C A 0.0000
196 E A -1.0502
197 V A 0.0000
198 T A -1.1761
199 H A 0.0000
200 Q A -1.6908
201 G A -0.3820
202 L A -0.0602
203 S A -0.3983
204 S A -0.3175
205 P A -0.4919
206 V A 0.0118
207 T A -0.4336
208 K A -0.6563
209 S A -0.5318
210 F A 0.0000
211 N A -1.4951
212 R A -2.0173
213 G A -1.5932
214 E A -2.0555
215 C A -1.7418
216 Q B -1.1768
217 V B -0.3183
218 Q B -0.9602
219 L B 0.0000
220 V B 0.1764
221 E B 0.0000
222 S B -0.5159
223 G B -0.7158
224 G B -0.3324
225 G B 0.2419
226 V B 0.3539
227 V B 0.0000
228 Q B -2.0411
229 P B -2.2156
230 G B -2.2828
231 R B -2.6897
232 S B -1.7156
233 L B -1.0633
234 R B -1.9098
235 L B 0.0000
236 S B -0.6182
237 C B 0.0000
238 A B -0.2778
239 A B 0.0000
240 S B -0.7076
241 G B -0.4845
242 F B 0.1371
243 T B -0.0004
244 F B 0.0000
245 S B -0.7226
246 S B -0.0086
247 Y B 0.3856
248 T B -0.0591
249 M B 0.0000
250 H B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B -0.5590
254 Q B -0.9474
255 A B -1.2048
256 P B -1.0516
257 G B -1.4995
258 K B -2.5155
259 G B -1.8304
260 L B 0.0000
261 E B -1.3742
262 W B 0.0000
263 V B 0.0000
264 T B 0.0000
265 F B -0.1465
266 I B 0.0000
267 S B 0.0000
268 Y B -0.3929
269 D B -2.0453
270 G B -2.2527
271 N B -2.6051
272 N B -2.5443
273 K B -1.8800
274 Y B -0.1903
275 Y B -0.7041
276 A B -1.2101
277 D B -2.5767
278 S B -2.0252
279 V B 0.0000
280 K B -2.6097
281 G B -1.8260
282 R B -1.9401
283 F B 0.0000
284 T B -1.1452
285 I B 0.0000
286 S B -0.8298
287 R B -1.0359
288 D B -1.8360
289 N B -1.8386
290 S B -1.6865
291 K B -2.4453
292 N B -1.8148
293 T B -1.0478
294 L B 0.0000
295 Y B -0.5236
296 L B 0.0000
297 Q B -1.3025
298 M B 0.0000
299 N B -1.7115
300 S B -1.6320
301 L B 0.0000
302 R B -3.1238
303 A B -2.0688
304 E B -2.4810
305 D B 0.0000
306 T B -0.6861
307 A B 0.0000
308 I B 0.4512
309 Y B 0.0000
310 Y B 0.0000
311 C B 0.0000
312 A B 0.0000
313 R B -0.0191
314 T B 0.4343
315 G B 0.5864
316 W B 1.5795
317 L B 2.0800
318 G B 0.0000
319 P B 0.0000
320 F B 0.0000
321 D B -0.6011
322 Y B -0.5446
323 W B 0.0000
324 G B 0.0000
325 Q B -1.2191
326 G B 0.0000
327 T B 0.0937
328 L B 0.6968
329 V B 0.0000
330 T B -0.0651
331 V B 0.0000
332 S B -0.9320
333 S B -0.7065
334 A B -0.6504
335 S B -0.8873
336 T B -1.0999
337 K B -2.0473
338 G B -1.6441
339 P B -0.9153
340 S B -0.6322
341 V B 0.0000
342 F B 0.0000
343 P B -1.3378
344 L B 0.0000
345 A B -0.9769
346 P B -0.7893
347 S B -1.1575
348 S B -1.6330
349 K B -2.0136
350 S B -1.4310
351 T B -0.9576
352 S B -0.9369
353 G B -0.7859
354 G B -0.7265
355 T B -0.5446
356 A B -0.3670
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.5356
364 D B -1.0272
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.4730
369 P B -0.6346
370 V B -0.5681
371 T B -0.5273
372 V B -0.1375
373 S B -0.3257
374 W B 0.0000
375 N B -0.8549
376 S B -0.6611
377 G B -0.3635
378 A B -0.1104
379 L B 0.1703
380 T B -0.0275
381 S B -0.0893
382 G B -0.0924
383 V B 0.3401
384 H B -0.1499
385 T B 0.1139
386 F B 0.0000
387 P B -0.0806
388 A B 0.4988
389 V B 0.7568
390 L B 1.3281
391 Q B -0.0849
392 S B -0.1393
393 S B -0.4116
394 G B 0.0000
395 L B -0.0828
396 Y B 0.1532
397 S B 0.0533
398 L B 0.0754
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0450
404 V B 0.0000
405 P B -0.5951
406 S B -0.6451
407 S B -0.7024
408 S B -0.8438
409 L B 0.0000
410 G B -1.2448
411 T B -0.9698
412 Q B -1.4404
413 T B -1.4676
414 Y B 0.0000
415 I B -1.5487
416 C B 0.0000
417 N B -1.5915
418 V B 0.0000
419 N B -1.8982
420 H B 0.0000
421 K B -2.6833
422 P B -1.6664
423 S B -1.9367
424 N B -2.5172
425 T B -2.0709
426 K B -2.6138
427 V B -1.7230
428 D B -2.6367
429 K B -2.2445
430 R B -2.9074
431 V B 0.0000
432 E B -2.9416
433 P B -2.2369
434 K B -2.8055
435 S B -1.7858
436 C B -1.6866
437 D B -2.0194
438 K B 0.0000
439 T B 0.0000
440 H B -1.7003
441 T B -1.3208
442 C B 0.0000
443 P B -1.1876
444 P B -0.9953
445 C B 0.0000
446 P B -1.0194
447 A B -1.0587
448 P B -0.8114
449 E B -1.1350
450 L B 0.2435
451 L B 1.2582
452 G B 0.0972
453 G B -0.1998
454 P B 0.0000
455 S B -0.1636
456 V B 0.0000
457 F B 0.8242
458 L B 0.0000
459 F B 1.2115
460 P B -0.0276
461 P B 0.0000
462 K B -2.0063
463 P B -1.2693
464 K B -1.0184
465 D B -1.3629
466 T B 0.0000
467 L B 0.0000
468 M B 0.5273
469 I B 1.4877
470 S B -0.0960
471 R B -1.3836
472 T B -0.8012
473 P B 0.0000
474 E B -1.3143
475 V B 0.0000
476 T B 0.5040
477 C B 0.0000
478 V B 0.0000
479 V B 0.0000
480 V B -0.4672
481 D B -1.0663
482 V B 0.0000
483 S B -1.9507
484 H B -2.3049
485 E B -2.8326
486 D B -2.4292
487 P B -2.4996
488 E B -2.8516
489 V B 0.0000
490 K B -2.4966
491 F B 0.0000
492 N B -1.7914
493 W B 0.0000
494 Y B -1.2328
495 V B -0.7380
496 D B -1.6706
497 G B -0.7285
498 V B 0.6861
499 E B -0.9447
500 V B 0.3165
501 H B -1.1276
502 N B -1.1646
503 A B -1.0372
504 K B -2.0274
505 T B -1.4162
506 K B -2.3391
507 P B -2.2347
508 R B -3.8447
509 E B -4.3068
510 E B -3.8597
511 Q B -2.9541
512 Y B -1.6520
513 N B -1.5420
514 S B -1.3759
515 T B -1.7350
516 Y B -2.7316
517 R B -2.4949
518 V B 0.0000
519 V B -1.0447
520 S B 0.0000
521 V B -0.1562
522 L B 0.0000
523 T B -0.5429
524 V B 0.0000
525 L B 0.8659
526 H B -0.1904
527 Q B -1.2712
528 D B -1.2689
529 W B 0.0000
530 L B -1.0951
531 N B -1.9621
532 G B -1.8534
533 K B -1.9963
534 E B -2.0464
535 Y B 0.0000
536 K B -1.9401
537 C B 0.0000
538 K B -1.9650
539 V B 0.0000
540 S B -1.4773
541 N B -1.8104
542 K B -2.0929
543 A B -1.2567
544 L B -0.5872
545 P B -0.4225
546 A B -0.3461
547 P B -0.5254
548 I B -0.4886
549 E B -1.6524
550 K B -1.3888
551 T B -1.1064
552 I B 0.0013
553 S B -1.3360
554 K B -1.3003
555 A B -1.2500
556 K B -2.2500
557 G B -2.1173
558 Q B -2.2108
559 P B -2.4318
560 R B -3.1372
561 E B -2.9146
562 P B 0.0000
563 Q B -1.4562
564 V B 0.0000
565 Y B 0.0000
566 T B -0.8335
567 L B 0.0000
568 P B -0.6307
569 P B -0.8750
570 S B -1.4922
571 R B -2.6710
572 D B -2.7568
573 E B 0.0000
574 L B -1.3995
575 T B -1.3404
576 K B -2.0499
577 N B -2.4675
578 Q B -2.3311
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B 0.0000
587 G B -1.1901
588 F B 0.0000
589 Y B -1.5295
590 P B 0.0000
591 S B -0.0490
592 D B -0.8977
593 I B -0.5201
594 A B 0.0000
595 V B 0.0000
596 E B -0.9564
597 W B 0.0000
598 E B -1.7612
599 S B 0.0000
600 N B -2.2402
601 G B -1.8224
602 Q B -1.9933
603 P B -1.8447
604 E B -2.1633
605 N B -2.0520
606 N B -1.6338
607 Y B -0.9043
608 K B -0.5325
609 T B -0.3147
610 T B 0.0000
611 P B -0.0239
612 P B 0.1916
613 V B 0.5527
614 L B 0.7741
615 D B -0.5478
616 S B -1.4065
617 D B -2.0263
618 G B -0.9624
619 S B -0.8924
620 F B 0.0000
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.9270
628 V B 0.0000
629 D B -2.6759
630 K B -2.5695
631 S B -2.2516
632 R B -2.6794
633 W B -2.4276
634 Q B -3.0161
635 Q B -2.9107
636 G B -2.2937
637 N B -1.9004
638 V B -1.2595
639 F B 0.0000
640 S B -1.1997
641 C B 0.0000
642 S B -0.7446
643 V B 0.0000
644 M B -0.3719
645 H B 0.0000
646 E B -1.3788
647 A B -1.9780
648 L B 0.0000
649 H B -1.6840
650 N B -1.5846
651 H B -0.7095
652 Y B -0.0820
653 T B -0.8884
654 Q B -1.4363
655 K B -1.4634
656 S B -0.8421
657 L B -0.5522
658 S B -1.2723
659 L B 0.0000
660 S B -1.4731
661 P B -1.0886
662 G B -1.6113
663 K B -2.7408
664 E C -1.4156
665 I C 0.2255
666 V C 0.0000
667 L C -0.4562
668 T C 0.0000
669 Q C -1.2047
670 S C -0.7605
671 P C 0.0000
672 G C -1.0012
673 T C -0.7395
674 L C -0.3650
675 S C -0.7283
676 L C 0.0000
677 S C -1.8217
678 P C -2.0509
679 G C -2.4646
680 E C -2.8375
681 R C -3.1201
682 A C 0.0000
683 T C -0.6381
684 L C 0.0000
685 S C -0.9515
686 C C 0.0000
687 R C -2.1109
688 A C 0.0000
689 S C -1.2527
690 Q C -1.9499
691 S C -1.5662
692 V C 0.0000
693 G C -0.3936
694 S C -0.2608
695 S C 0.0000
696 Y C 0.8910
697 L C 0.0000
698 A C 0.0000
699 W C 0.0000
700 Y C 0.0000
701 Q C 0.0000
702 Q C -1.2312
703 K C -1.5844
704 P C -1.2569
705 G C -1.5781
706 Q C -2.1079
707 A C -1.5404
708 P C 0.0000
709 R C -1.8128
710 L C 0.0000
711 L C 0.0000
712 I C 0.0000
713 Y C 1.8471
714 L C 1.9277
715 V C 1.7277
716 L C 1.8514
717 Y C 2.4346
718 L C 1.6562
719 I C 0.0000
720 I C 2.1603
721 G C 0.5812
722 I C 0.3937
723 P C -0.8064
724 D C -1.8547
725 R C -1.7478
726 F C 0.0000
727 S C -0.0274
728 G C 0.0000
729 S C 0.0882
730 G C -0.6425
731 S C -0.7931
732 G C -1.2226
733 T C -1.8410
734 D C -2.3902
735 F C 0.0000
736 T C -0.6432
737 L C 0.0000
738 T C -0.7255
739 I C 0.0000
740 S C -2.4469
741 R C -3.3113
742 L C 0.0000
743 E C -2.0222
744 P C -1.8457
745 E C -2.1894
746 D C 0.0000
747 F C -1.0894
748 A C 0.0000
749 V C -0.5308
750 Y C 0.0000
751 Y C 0.0000
752 C C 0.0000
753 Q C 0.0000
754 Q C 0.0000
755 Y C 0.1595
756 G C -0.4387
757 S C -0.6525
758 S C -0.3990
759 P C -0.6293
760 W C -0.4338
761 T C -0.4597
762 F C 0.0000
763 G C 0.0000
764 Q C -1.6516
765 G C -1.2535
766 T C 0.0000
767 K C -1.5822
768 V C 0.0000
769 E C -1.1115
770 I C 0.0000
771 K C -1.3608
772 R C -1.5836
773 T C -0.0444
774 V C 1.0503
775 A C 0.4043
776 A C 0.1179
777 P C -0.2742
778 S C -0.2766
779 V C 0.0000
780 F C 0.2232
781 I C 0.0000
782 F C 0.0000
783 P C 0.0000
784 P C 0.0000
785 S C 0.0000
786 D C -2.7588
787 E C -2.8864
788 Q C 0.0000
789 L C 0.0000
790 K C -2.8304
791 S C -1.7751
792 G C -1.3016
793 T C -0.9338
794 A C 0.0000
795 S C 0.0000
796 V C 0.0000
797 V C 0.0000
798 C C 0.0000
799 L C 0.0000
800 L C 0.0000
801 N C 0.0000
802 N C -0.9989
803 F C 0.0000
804 Y C 0.0000
805 P C -1.7442
806 R C -3.1802
807 E C -3.2737
808 A C -2.4054
809 K C -2.2663
810 V C -1.1260
811 Q C -0.9143
812 W C 0.0000
813 K C -0.5835
814 V C -0.8055
815 D C -1.4954
816 N C -1.3119
817 A C -0.3161
818 L C 0.3853
819 Q C -0.9728
820 S C -0.7931
821 G C -1.2734
822 N C -1.9738
823 S C -1.5886
824 Q C -1.2847
825 E C -1.7120
826 S C 0.0000
827 V C -0.7603
828 T C -1.1652
829 E C -2.3900
830 Q C 0.0000
831 D C -2.8596
832 S C -2.6107
833 K C -2.9903
834 D C -3.2297
835 S C 0.0000
836 T C -2.0288
837 Y C 0.0000
838 S C 0.0000
839 L C -0.6501
840 S C 0.0000
841 S C 0.0000
842 T C -0.6961
843 L C 0.0000
844 T C -0.5987
845 L C -0.6283
846 S C -1.0480
847 K C -2.1288
848 A C -2.0244
849 D C -2.2025
850 Y C 0.0000
851 E C -3.6594
852 K C -3.4798
853 H C -2.9721
854 K C -3.0612
855 V C -1.2680
856 Y C 0.0000
857 A C -0.8183
858 C C 0.0000
859 E C -0.9167
860 V C 0.0000
861 T C -1.0510
862 H C 0.0000
863 Q C -1.7371
864 G C -0.3681
865 L C -0.0482
866 S C -0.3941
867 S C -0.3218
868 P C -0.4353
869 V C -0.0165
870 T C -0.4723
871 K C -0.8048
872 S C -0.6103
873 F C 0.0000
874 N C -1.5275
875 R C -2.0153
876 G C -1.5184
877 E C -1.2065
878 C C -0.3782
879 Q D -1.4234
880 V D -0.8961
881 Q D -1.1891
882 L D 0.0000
883 V D 0.6843
884 E D 0.0000
885 S D -0.2913
886 G D -0.5577
887 G D -0.0779
888 G D 0.5076
889 V D 0.5853
890 V D 0.0000
891 Q D -1.9059
892 P D -2.1993
893 G D -2.3560
894 R D -2.7264
895 S D -1.9149
896 L D -0.9328
897 R D -1.8315
898 L D 0.0000
899 S D -0.5162
900 C D 0.0000
901 A D -0.1336
902 A D 0.0000
903 S D -0.8570
904 G D -0.8502
905 F D -0.1243
906 T D -0.0913
907 F D 0.0000
908 S D -0.7892
909 S D -0.1235
910 Y D 0.4779
911 T D 0.0000
912 M D 0.0000
913 H D 0.0000
914 W D 0.0000
915 V D 0.0000
916 R D 0.0000
917 Q D -0.9562
918 A D -1.1789
919 P D -1.0823
920 G D -1.4701
921 K D -2.5387
922 G D -1.8968
923 L D -1.3832
924 E D -1.9847
925 W D 0.0000
926 V D 0.0000
927 T D 0.0000
928 F D 0.1276
929 I D 0.0000
930 S D -0.9267
931 Y D -0.6999
932 D D -2.1748
933 G D -2.0604
934 N D -2.4333
935 N D -2.1771
936 K D -1.0760
937 Y D 0.1969
938 Y D -0.4470
939 A D -1.3146
940 D D -2.7077
941 S D -2.2689
942 V D 0.0000
943 K D -3.0077
944 G D -2.5089
945 R D -3.3704
946 F D 0.0000
947 T D -1.3846
948 I D 0.0000
949 S D -0.6333
950 R D -0.9995
951 D D -1.6610
952 N D -1.7110
953 S D -1.5954
954 K D -2.4125
955 N D -1.8263
956 T D -0.9563
957 L D 0.0000
958 Y D -0.4552
959 L D 0.0000
960 Q D -1.5052
961 M D 0.0000
962 N D -2.4305
963 S D -2.2233
964 L D 0.0000
965 R D -3.3037
966 A D -2.0656
967 E D -2.4892
968 D D 0.0000
969 T D -0.5271
970 A D 0.0000
971 I D 0.7495
972 Y D 0.0000
973 Y D 0.0000
974 C D 0.0000
975 A D 0.0000
976 R D 0.0000
977 T D 0.0000
978 G D 0.0000
979 W D 2.0641
980 L D 2.1702
981 G D 1.4500
982 P D 0.0000
983 F D 0.0000
984 D D 0.0000
985 Y D -0.1254
986 W D 0.0000
987 G D 0.0000
988 Q D -0.9811
989 G D 0.0000
990 T D 0.5576
991 L D 1.4193
992 V D 0.0000
993 T D 0.1488
994 V D 0.0000
995 S D -0.8783
996 S D -0.6536
997 A D -0.4716
998 S D -0.6317
999 T D -0.7146
1000 K D -1.3028
1001 G D -1.5642
1002 P D -0.8433
1003 S D -0.4447
1004 V D 0.0000
1005 F D -0.7016
1006 P D -1.2954
1007 L D 0.0000
1008 A D 0.0000
1009 P D -0.6541
1010 S D -0.9649
1011 S D -1.1950
1012 K D -2.0201
1013 S D -1.2517
1014 T D -0.9807
1015 S D -0.9066
1016 G D -0.7747
1017 G D -0.7076
1018 T D -0.5124
1019 A D 0.0000
1020 A D 0.0000
1021 L D 0.0000
1022 G D 0.0000
1023 C D 0.0000
1024 L D 0.0000
1025 V D 0.0000
1026 K D -0.5790
1027 D D -0.9058
1028 Y D 0.0000
1029 F D 0.0000
1030 P D 0.0000
1031 E D -0.3564
1032 P D -0.6378
1033 V D -0.6529
1034 T D -0.6172
1035 V D -0.3707
1036 S D -0.3781
1037 W D 0.0000
1038 N D -0.8984
1039 S D -0.7071
1040 G D -0.4666
1041 A D -0.2299
1042 L D -0.0196
1043 T D -0.1178
1044 S D -0.1078
1045 G D -0.0322
1046 V D 0.3305
1047 H D -0.1116
1048 T D 0.0665
1049 F D 0.0000
1050 P D -0.2577
1051 A D 0.2654
1052 V D 0.7297
1053 L D 1.3438
1054 Q D -0.0817
1055 S D -0.1320
1056 S D -0.2337
1057 G D 0.0000
1058 L D 0.0624
1059 Y D 0.3118
1060 S D 0.0000
1061 L D 0.0647
1062 S D 0.0000
1063 S D 0.0000
1064 V D 0.0000
1065 V D 0.0000
1066 T D -0.0612
1067 V D 0.0000
1068 P D -0.5643
1069 S D -0.5922
1070 S D -0.6810
1071 S D -0.7533
1072 L D -0.9221
1073 G D -1.1963
1074 T D -0.9259
1075 Q D -1.3841
1076 T D -1.3687
1077 Y D 0.0000
1078 I D -1.3292
1079 C D 0.0000
1080 N D -1.6033
1081 V D 0.0000
1082 N D -2.1712
1083 H D 0.0000
1084 K D -2.7543
1085 P D -1.6086
1086 S D -1.8747
1087 N D -2.5655
1088 T D -2.2011
1089 K D -2.6944
1090 V D -1.7682
1091 D D -2.6001
1092 K D -2.1420
1093 R D -2.8388
1094 V D 0.0000
1095 E D -2.6445
1096 P D -1.6081
1097 K D -1.0658
1098 S D -1.0607
1099 C D -0.5549
1100 D D -1.6244
1101 K D -2.1619
1102 T D -1.7148
1103 H D -1.6045
1104 T D -1.4811
1105 C D -1.3125
1106 P D -1.0934
1107 P D -0.9432
1108 C D 0.0000
1109 P D -0.8441
1110 A D 0.0000
1111 P D -1.0175
1112 E D -1.3740
1113 L D 0.0140
1114 L D 1.1305
1115 G D 0.0160
1116 G D -0.0847
1117 P D -0.1305
1118 S D 0.1771
1119 V D 0.0000
1120 F D 1.9529
1121 L D 0.0000
1122 F D 2.1059
1123 P D 0.6039
1124 P D 0.0000
1125 K D -2.0800
1126 P D -1.7286
1127 K D -1.7201
1128 D D -1.3648
1129 T D 0.0000
1130 L D 0.0000
1131 M D 0.4607
1132 I D 1.3760
1133 S D -0.0516
1134 R D -1.3587
1135 T D -0.6493
1136 P D 0.0000
1137 E D -0.4847
1138 V D 0.0000
1139 T D 1.1104
1140 C D 0.0000
1141 V D 0.0000
1142 V D 0.0000
1143 V D 0.0200
1144 D D -0.2019
1145 V D 0.0000
1146 S D -1.7611
1147 H D -2.3670
1148 E D -2.8452
1149 D D -2.3321
1150 P D -2.4535
1151 E D -2.8436
1152 V D 0.0000
1153 K D -2.6888
1154 F D 0.0000
1155 N D -1.5667
1156 W D 0.0000
1157 Y D -0.9732
1158 V D -0.8023
1159 D D -1.9916
1160 G D -0.6428
1161 V D 0.9473
1162 E D -0.1390
1163 V D 0.2917
1164 H D -1.2109
1165 N D -1.0691
1166 A D -1.0178
1167 K D -2.1801
1168 T D 0.0000
1169 K D -2.0789
1170 P D -2.1373
1171 R D -3.1444
1172 E D -3.5463
1173 E D -3.2389
1174 Q D -1.9214
1175 Y D -0.7058
1176 N D -0.6287
1177 S D -0.6398
1178 T D -1.0188
1179 Y D 0.0000
1180 R D -1.9494
1181 V D 0.0000
1182 V D -0.8007
1183 S D 0.0000
1184 V D 0.3461
1185 L D 0.0000
1186 T D -0.0844
1187 V D 0.5460
1188 L D 1.0221
1189 H D -0.0895
1190 Q D -1.1795
1191 D D -1.3178
1192 W D 0.0000
1193 L D -1.1297
1194 N D -2.1766
1195 G D -2.2362
1196 K D -2.3520
1197 E D -2.3727
1198 Y D 0.0000
1199 K D -1.8930
1200 C D 0.0000
1201 K D -1.7907
1202 V D 0.0000
1203 S D -1.4534
1204 N D -1.8343
1205 K D -2.0862
1206 A D -1.2918
1207 L D -0.5946
1208 P D -0.4813
1209 A D -0.3171
1210 P D -0.4756
1211 I D -0.4330
1212 E D -1.5650
1213 K D -1.3544
1214 T D -1.1333
1215 I D 0.0350
1216 S D -1.6016
1217 K D -1.4802
1218 A D -1.4363
1219 K D -2.3774
1220 G D -2.1375
1221 Q D -2.4059
1222 P D -2.4511
1223 R D -3.1222
1224 E D -3.0677
1225 P D 0.0000
1226 Q D -1.3378
1227 V D 0.0000
1228 Y D 0.0000
1229 T D -0.7887
1230 L D 0.0000
1231 P D -0.3929
1232 P D -0.7883
1233 S D -1.4226
1234 R D -2.5947
1235 D D -2.7627
1236 E D 0.0000
1237 L D -1.2776
1238 T D -1.4309
1239 K D -2.3856
1240 N D -2.5944
1241 Q D -2.5078
1242 V D 0.0000
1243 S D 0.0000
1244 L D 0.0000
1245 T D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 V D 0.0000
1249 K D -0.6096
1250 G D -1.1293
1251 F D 0.0000
1252 Y D -1.5069
1253 P D -1.2247
1254 S D -0.4013
1255 D D -1.4742
1256 I D 0.0000
1257 A D 0.0000
1258 V D 0.0000
1259 E D -1.9635
1260 W D 0.0000
1261 E D -2.4275
1262 S D 0.0000
1263 N D -2.4802
1264 G D -2.1063
1265 Q D -2.4685
1266 P D -2.5121
1267 E D -3.0955
1268 N D -2.5953
1269 N D -1.9191
1270 Y D -1.4397
1271 K D -1.0431
1272 T D -0.6276
1273 T D 0.0000
1274 P D 0.0120
1275 P D 0.2698
1276 V D 0.9153
1277 L D 1.1247
1278 D D -0.2784
1279 S D -1.2324
1280 D D -1.9665
1281 G D -0.8649
1282 S D -0.7532
1283 F D 0.2159
1284 F D 0.0000
1285 L D 0.0000
1286 Y D 0.0000
1287 S D 0.0000
1288 K D 0.0000
1289 L D 0.0000
1290 T D -1.0425
1291 V D 0.0000
1292 D D -2.8321
1293 K D -2.7433
1294 S D -2.6538
1295 R D -3.4819
1296 W D -2.5804
1297 Q D -2.9434
1298 Q D -2.9904
1299 G D -2.2719
1300 N D -2.0850
1301 V D -1.2225
1302 F D 0.0000
1303 S D -1.3503
1304 C D 0.0000
1305 S D -1.0415
1306 V D 0.0000
1307 M D 0.0000
1308 H D 0.0000
1309 E D -1.4579
1310 A D -2.0019
1311 L D 0.0000
1312 H D -1.7507
1313 N D -1.6374
1314 H D -1.0578
1315 Y D -0.3129
1316 T D -0.9513
1317 Q D -1.4682
1318 K D -1.2879
1319 S D -0.7886
1320 L D 0.0000
1321 S D -0.7151
1322 L D 0.0000
1323 S D -1.2102
1324 P D -1.0021
1325 G D -1.2400
1326 K D -1.7620

 

Laboratory of Theory of Biopolymers 2015