Project name: be20aac82cc6f7e

Status: done

submitted: 2017-11-14 10:16:16, status changed: 2017-11-14 11:43:30
Settings
Chain sequence(s) A: ELQMTQSPSSLSASVGDRVTITCCIIWLAFVPIYWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: ELQMTQSPSSLSASVGDRVTITCCIIWLAFVPIYWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2771
Maximal score value
2.7893
Average score
-0.748
Total score value
-1003.79

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.7070
2 L A 0.6747
3 Q A 0.0000
4 M A -0.0346
5 T A 0.0000
6 Q A -1.4563
7 S A -0.9136
8 P A -1.1258
9 S A -0.8755
10 S A -0.6640
11 L A -0.3490
12 S A -0.8171
13 A A 0.0000
14 S A -1.1102
15 V A 0.1493
16 G A -0.6984
17 D A -1.8459
18 R A -2.2911
19 V A 0.0000
20 T A -0.7153
21 I A 0.0000
22 T A -0.7239
23 C A 0.0000
24 C A 0.1892
25 I A 0.0000
26 I A 1.5778
27 W A 2.2826
28 L A 2.6863
29 A A 0.0000
30 F A 2.7348
31 V A 1.4226
32 P A 1.0190
33 I A 0.0000
34 Y A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.3183
39 K A -1.6851
40 P A -1.4345
41 G A -1.4507
42 Q A -2.1613
43 P A -1.6044
44 P A 0.0000
45 K A -1.6859
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 W A 0.4470
51 A A 0.0797
52 S A -0.6460
53 T A -0.9266
54 R A -2.3875
55 E A -1.4404
56 S A -1.0351
57 G A -1.2627
58 V A 0.0000
59 P A -1.5237
60 D A -2.3290
61 R A -1.4814
62 F A 0.0000
63 S A -1.0383
64 G A -0.5546
65 S A -0.5288
66 G A -0.4984
67 S A 0.2101
68 G A 1.2317
69 T A 0.5430
70 D A -0.7947
71 F A 0.0000
72 T A -0.6537
73 L A 0.0000
74 T A -0.5577
75 I A 0.0000
76 S A -1.4005
77 S A -1.0036
78 L A 0.0000
79 Q A -0.6575
80 P A -1.2096
81 E A -1.5593
82 D A 0.0000
83 S A -1.1507
84 A A 0.0000
85 T A -0.7940
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 S A 0.0000
92 Y A 0.8450
93 D A -1.2163
94 I A -0.1168
95 P A -0.5102
96 Y A -0.4002
97 T A -0.5953
98 F A 0.0000
99 G A 0.0000
100 Q A -1.8511
101 G A -1.4052
102 T A 0.0000
103 K A -1.1251
104 L A 0.0000
105 E A -1.5054
106 I A 0.0000
107 K A -2.0397
108 R A -2.0956
109 T A -0.5049
110 V A 0.8083
111 A A 0.3045
112 A A 0.1301
113 P A -0.1782
114 S A -0.2825
115 V A 0.0000
116 F A 0.1006
117 I A 0.0000
118 F A 0.0000
119 P A -0.3547
120 P A 0.0000
121 S A 0.0000
122 D A -3.0146
123 E A -2.7034
124 Q A 0.0000
125 L A 0.0000
126 K A -2.8689
127 S A -1.7058
128 G A -1.1749
129 T A -0.7875
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -0.8426
139 F A 0.0000
140 Y A 0.0000
141 P A -1.8845
142 R A -3.2513
143 E A -3.3203
144 A A -2.6379
145 K A -2.7191
146 V A 0.0000
147 Q A -1.5124
148 W A 0.0000
149 K A -0.5282
150 V A -0.6278
151 D A -1.2438
152 N A -1.1715
153 A A -0.3128
154 L A 0.4028
155 Q A -1.0544
156 S A -0.7793
157 G A -1.2621
158 N A -1.9695
159 S A -1.7121
160 Q A -1.4423
161 E A -2.0143
162 S A 0.0000
163 V A -0.8916
164 T A -1.1994
165 E A -2.3388
166 Q A -2.3943
167 D A -2.4955
168 S A -2.2404
169 K A -2.5085
170 D A -2.3343
171 S A 0.0000
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A 0.0000
176 S A 0.0000
177 S A 0.0000
178 T A -0.7560
179 L A 0.0000
180 T A -0.5371
181 L A -0.5225
182 S A -0.8914
183 K A -1.4680
184 A A -1.4584
185 D A -1.7433
186 Y A 0.0000
187 E A -1.9545
188 K A -2.7112
189 H A -2.0610
190 K A -1.7434
191 V A -0.8163
192 Y A 0.0000
193 A A -0.7065
194 C A 0.0000
195 E A -1.1168
196 V A 0.0000
197 T A -1.2861
198 H A 0.0000
199 Q A -1.7495
200 G A -0.3491
201 L A 0.0157
202 S A -0.3623
203 S A -0.3033
204 P A -0.4629
205 V A 0.0362
206 T A -0.4593
207 K A -0.5943
208 S A -0.4671
209 F A 0.0000
210 N A -1.0761
211 R A -1.5389
212 G A -1.5046
213 E A -2.4685
214 C A -1.8408
215 E B -1.7583
216 V B -0.5847
217 Q B -1.0733
218 L B 0.0000
219 L B 0.6484
220 E B 0.0000
221 S B -0.4780
222 G B -0.9073
223 G B -0.6779
224 G B -0.1204
225 V B 0.2535
226 V B -0.6756
227 Q B -1.9582
228 P B -2.1474
229 G B -2.2956
230 R B -2.8112
231 S B -2.1485
232 L B -1.5591
233 R B -2.1353
234 L B 0.0000
235 S B -0.5250
236 C B 0.0000
237 A B -0.1216
238 A B -0.2923
239 S B -0.8058
240 G B -0.7502
241 F B -0.0546
242 T B -0.0319
243 F B 0.0000
244 S B -0.8294
245 S B 0.0429
246 Y B 0.0000
247 G B 0.0000
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -1.2169
254 A B -1.4311
255 P B -1.1013
256 G B -1.4862
257 K B -2.5744
258 G B -1.9547
259 L B -1.4398
260 E B -2.0000
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.0000
265 I B 0.0000
266 S B -0.9795
267 Y B -0.5598
268 D B -1.9198
269 G B -1.6750
270 S B -1.5003
271 N B -1.9116
272 K B -1.4229
273 Y B 0.0269
274 Y B -0.7508
275 A B -1.4089
276 D B -2.6709
277 S B -2.2580
278 V B 0.0000
279 K B -2.8973
280 G B -2.2863
281 R B -2.9039
282 F B 0.0000
283 T B -1.3375
284 I B 0.0000
285 S B -0.5531
286 R B -1.0320
287 D B -1.5879
288 N B -1.7045
289 S B -1.5653
290 K B -2.3851
291 N B -1.8118
292 T B -0.9359
293 L B 0.0000
294 Y B -0.4864
295 L B 0.0000
296 Q B -1.5652
297 M B 0.0000
298 N B -2.3391
299 S B -2.0474
300 L B 0.0000
301 R B -3.2841
302 A B -2.0906
303 E B -2.5689
304 D B -1.7065
305 T B -0.9030
306 A B 0.0000
307 V B -0.1061
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 D B 0.3667
314 M B 0.6548
315 G B 0.0000
316 W B 1.4361
317 G B 0.6503
318 S B 0.1885
319 G B 0.3113
320 W B 0.3143
321 R B -1.0520
322 P B 0.0245
323 Y B 1.3372
324 Y B 1.1131
325 Y B 1.1423
326 Y B 0.9379
327 G B 0.0000
328 M B 0.0000
329 D B -0.4102
330 V B -0.3930
331 W B 0.0000
332 G B 0.0000
333 Q B -1.2204
334 G B -0.5683
335 T B -0.2910
336 T B -0.2629
337 V B 0.0000
338 T B -0.2822
339 V B 0.0000
340 S B -0.8538
341 S B -0.6257
342 A B -0.5178
343 S B -0.7752
344 T B -0.9381
345 K B -1.6977
346 G B -1.6776
347 P B -0.8256
348 S B -0.4755
349 V B 0.0000
350 F B 0.0000
351 P B -1.2976
352 L B 0.0000
353 A B -0.9430
354 P B -0.7785
355 S B -1.1970
356 S B -1.7040
357 K B -2.1347
358 S B -1.6000
359 T B -0.9597
360 S B -0.8789
361 G B -0.7662
362 G B -0.6934
363 T B -0.5077
364 A B 0.0000
365 A B 0.0000
366 L B 0.0000
367 G B 0.0000
368 C B 0.0000
369 L B 0.0000
370 V B 0.0000
371 K B -0.4423
372 D B -0.6923
373 Y B 0.0000
374 F B 0.0000
375 P B 0.0000
376 E B -0.7630
377 P B -0.8747
378 V B -0.6231
379 T B -0.5466
380 V B -0.3007
381 S B -0.3259
382 W B 0.0000
383 N B -0.8581
384 S B -0.6745
385 G B -0.3735
386 A B -0.1669
387 L B 0.0826
388 T B -0.0649
389 S B -0.0802
390 G B -0.0918
391 V B 0.3648
392 H B -0.0999
393 T B 0.0682
394 F B 0.0000
395 P B -0.2524
396 A B 0.4188
397 V B 0.7230
398 L B 1.4178
399 Q B 0.1174
400 S B -0.0383
401 S B -0.2667
402 G B 0.0000
403 L B 0.1808
404 Y B 0.2849
405 S B 0.1844
406 L B 0.0693
407 S B 0.0000
408 S B 0.0000
409 V B 0.0000
410 V B 0.0000
411 T B -0.0506
412 V B 0.0000
413 P B -0.5637
414 S B -0.5906
415 S B -0.6745
416 S B -0.8021
417 L B -0.9088
418 G B -1.1815
419 T B -0.9371
420 Q B -1.4018
421 T B -1.3459
422 Y B 0.0000
423 I B -1.4051
424 C B 0.0000
425 N B -1.5740
426 V B 0.0000
427 N B -1.9646
428 H B 0.0000
429 K B -2.7583
430 P B -1.7285
431 S B -1.9455
432 N B -2.5776
433 T B -2.1638
434 K B -2.6421
435 V B -1.8131
436 D B -2.6569
437 K B -2.2558
438 K B -2.6809
439 V B 0.0000
440 E B -2.8319
441 P B -2.1636
442 K B -2.8351
443 S B -2.0750
444 C B -2.0518
445 D B -2.2372
446 K B -2.6893
447 T B -1.6437
448 H B -1.6254
449 T B -1.1796
450 C B -1.3073
451 P B -0.8798
452 P B -0.5560
453 C B 0.0625
454 P B -0.3770
455 A B -0.3259
456 P B -0.6856
457 E B -0.7551
458 L B 1.0838
459 L B 1.5343
460 G B 0.2978
461 G B 0.0293
462 P B -0.3132
463 S B 0.0260
464 V B 0.0000
465 F B 1.0622
466 L B 0.0000
467 F B 1.4073
468 P B 0.0876
469 P B 0.0000
470 K B -2.1079
471 P B -1.4115
472 K B -1.4930
473 D B 0.0000
474 T B 0.0000
475 L B 0.0000
476 M B 0.4421
477 I B 1.5239
478 S B -0.0380
479 R B -1.3795
480 T B -0.7648
481 P B 0.0000
482 E B -1.1563
483 V B 0.0000
484 T B 0.6309
485 C B 0.0000
486 V B 0.0000
487 V B 0.0000
488 V B -0.3152
489 D B -0.9078
490 V B 0.0000
491 S B -1.9650
492 H B -2.3158
493 E B -2.9065
494 D B -2.5316
495 P B -2.7472
496 E B -3.3714
497 V B 0.0000
498 K B -2.7002
499 F B 0.0000
500 N B -2.2224
501 W B 0.0000
502 Y B -1.3887
503 V B -0.8057
504 D B -1.6828
505 G B -0.7898
506 V B 0.5364
507 E B -1.2452
508 V B -0.2314
509 H B -1.4779
510 N B -1.3334
511 A B -1.0185
512 K B -2.0741
513 T B 0.0000
514 K B -2.2421
515 P B -2.1585
516 R B -3.9112
517 E B -4.2771
518 E B -3.7526
519 Q B -2.7783
520 Y B -1.2970
521 N B -1.3751
522 S B -1.2770
523 T B -1.6057
524 Y B -2.5318
525 R B -2.4465
526 V B 0.0000
527 V B -1.0245
528 S B 0.0000
529 V B 0.0374
530 L B 0.0000
531 T B -0.3156
532 V B 0.3426
533 L B 0.9425
534 H B 0.0000
535 Q B -1.1462
536 D B -1.1272
537 W B 0.0000
538 L B -0.8743
539 N B -1.9391
540 G B -1.8813
541 K B -1.9429
542 E B -2.1215
543 Y B 0.0000
544 K B -1.9987
545 C B 0.0000
546 K B -2.0361
547 V B 0.0000
548 S B -1.6031
549 N B -1.9423
550 K B -2.0972
551 A B -1.2546
552 L B -0.6135
553 P B -0.4495
554 A B -0.3980
555 P B -0.5980
556 I B -0.6768
557 E B -1.7420
558 K B -1.5798
559 T B -1.1959
560 I B -0.1025
561 S B -1.4677
562 K B -1.4227
563 A B -1.2974
564 K B -2.3366
565 G B -2.1296
566 Q B -2.1940
567 P B -2.3057
568 R B -2.9809
569 E B -2.9096
570 P B 0.0000
571 Q B -1.3985
572 V B 0.0000
573 Y B 0.0000
574 T B -0.6706
575 L B -0.2886
576 P B -0.2367
577 P B 0.0000
578 S B -1.4165
579 R B -2.6872
580 D B -2.7659
581 E B 0.0000
582 L B -1.5963
583 T B -1.6590
584 K B -2.5930
585 N B -2.7254
586 Q B -2.6827
587 V B 0.0000
588 S B 0.0000
589 L B 0.0000
590 T B 0.0000
591 C B 0.0000
592 L B 0.0000
593 V B 0.0000
594 K B 0.0000
595 G B -1.0930
596 F B 0.0000
597 Y B -1.3506
598 P B 0.0000
599 S B -0.0995
600 D B -0.8268
601 I B 0.0000
602 A B -0.7260
603 V B 0.0000
604 E B -1.8454
605 W B 0.0000
606 E B -2.1386
607 S B 0.0000
608 N B -2.3234
609 G B -1.9609
610 Q B -2.3956
611 P B -2.4296
612 E B -2.9997
613 N B -2.4848
614 N B -1.7859
615 Y B -1.3072
616 K B -0.9395
617 T B -0.5556
618 T B 0.0000
619 P B 0.0359
620 P B 0.3621
621 V B 0.9065
622 L B 1.1633
623 D B -0.2266
624 S B -1.1991
625 D B -1.9098
626 G B -0.7505
627 S B -0.6788
628 F B 0.2426
629 F B 0.0000
630 L B 0.0000
631 Y B 0.0000
632 S B 0.0000
633 K B 0.0000
634 L B 0.0000
635 T B -0.9255
636 V B -1.3736
637 D B -2.5888
638 K B -2.8859
639 S B -2.6217
640 R B -3.2829
641 W B -2.4240
642 Q B -2.8537
643 Q B -2.8302
644 G B -1.6642
645 N B -1.6398
646 V B -0.5033
647 F B 0.0000
648 S B -1.1202
649 C B 0.0000
650 S B 0.0000
651 V B 0.0000
652 M B -0.7705
653 H B 0.0000
654 E B -1.2167
655 A B -1.9431
656 L B 0.0000
657 H B -1.8691
658 N B -1.7701
659 H B -1.3344
660 Y B -0.7382
661 T B -1.0556
662 Q B -1.2445
663 K B -1.1654
664 S B -0.3495
665 L B 0.0000
666 S B 0.2430
667 L B 1.2363
668 S B 0.2357
669 P B -0.4019
670 G B -0.8910
671 K B -0.7294
672 E C -0.6400
673 L C 0.6835
674 Q C 0.0000
675 M C 0.1071
676 T C 0.0000
677 Q C -1.5209
678 S C -1.1018
679 P C -1.2624
680 S C -1.1868
681 S C -1.1078
682 L C -0.6758
683 S C -0.9369
684 A C 0.0000
685 S C -1.2081
686 V C -0.5270
687 G C -1.1295
688 D C -1.9799
689 R C -2.4799
690 V C 0.0000
691 T C -0.7416
692 I C 0.0000
693 T C -0.8188
694 C C 0.0000
695 C C 0.2290
696 I C 0.0000
697 I C 2.0784
698 W C 2.5988
699 L C 2.7378
700 A C 0.0000
701 F C 2.7893
702 V C 1.6682
703 P C 0.0000
704 I C 0.0000
705 Y C 0.0000
706 W C 0.0000
707 Y C 0.0000
708 Q C 0.0000
709 Q C -1.2905
710 K C -1.8990
711 P C -1.6082
712 G C -1.6396
713 Q C -2.0146
714 P C -1.4387
715 P C 0.0000
716 K C -1.1311
717 L C 0.0000
718 L C 0.0000
719 I C 0.0000
720 Y C 0.0000
721 W C 1.3489
722 A C 0.6528
723 S C -0.0589
724 T C -0.1439
725 R C -1.2040
726 E C -0.6446
727 S C -0.7007
728 G C -0.8380
729 V C -0.8086
730 P C -1.2673
731 D C -2.1739
732 R C -1.5460
733 F C 0.0000
734 S C -0.7869
735 G C -0.2292
736 S C -0.4659
737 G C -0.5215
738 S C 0.1556
739 G C 1.1223
740 T C 0.4442
741 D C -1.2206
742 F C 0.0000
743 T C -0.7487
744 L C 0.0000
745 T C -0.5724
746 I C 0.0000
747 S C -1.6473
748 S C -1.3393
749 L C 0.0000
750 Q C -1.0910
751 P C -1.5948
752 E C -2.1872
753 D C 0.0000
754 S C -1.4275
755 A C 0.0000
756 T C -1.1338
757 Y C 0.0000
758 Y C 0.0000
759 C C 0.0000
760 Q C 0.0000
761 Q C 0.0000
762 S C 0.4266
763 Y C 1.0715
764 D C -1.1267
765 I C -0.0309
766 P C -0.4904
767 Y C -0.3977
768 T C -0.6549
769 F C 0.0000
770 G C 0.0000
771 Q C -1.9225
772 G C -1.5021
773 T C 0.0000
774 K C -1.8798
775 L C 0.0000
776 E C -1.4301
777 I C 0.0000
778 K C -1.6206
779 R C -1.5501
780 T C -0.1123
781 V C 1.0104
782 A C 0.4441
783 A C 0.1597
784 P C -0.0701
785 S C -0.2350
786 V C 0.0000
787 F C 0.1970
788 I C 0.0000
789 F C 0.0000
790 P C -0.6370
791 P C 0.0000
792 S C 0.0000
793 D C -2.5733
794 E C -2.1433
795 Q C 0.0000
796 L C -1.8877
797 K C -2.4919
798 S C -1.5240
799 G C -1.0971
800 T C -0.8508
801 A C 0.0000
802 S C 0.0000
803 V C 0.0000
804 V C 0.0000
805 C C 0.0000
806 L C 0.0000
807 L C 0.0000
808 N C 0.0000
809 N C -0.9582
810 F C 0.0000
811 Y C 0.0000
812 P C -1.7443
813 R C -3.2397
814 E C -3.3160
815 A C -2.5709
816 K C -2.7824
817 V C 0.0000
818 Q C -0.9505
819 W C 0.0000
820 K C -0.3738
821 V C -0.6799
822 D C -1.4245
823 N C -1.2585
824 A C -0.2032
825 L C 0.5991
826 Q C -0.4998
827 S C -0.6244
828 G C -1.1864
829 N C -1.9019
830 S C -1.5509
831 Q C -1.3075
832 E C -2.1167
833 S C 0.0000
834 V C -0.8335
835 T C -1.1710
836 E C -2.3910
837 Q C -2.4546
838 D C -2.6412
839 S C -2.5942
840 K C -2.9443
841 D C -3.1823
842 S C 0.0000
843 T C -2.0189
844 Y C 0.0000
845 S C 0.0000
846 L C 0.0000
847 S C 0.0000
848 S C 0.0000
849 T C -0.7204
850 L C 0.0000
851 T C -0.5578
852 L C -0.7063
853 S C -1.3429
854 K C -2.1832
855 A C -2.2555
856 D C -2.8460
857 Y C 0.0000
858 E C -3.8396
859 K C -3.7481
860 H C -3.2278
861 K C -3.3177
862 V C -1.5752
863 Y C 0.0000
864 A C -0.8081
865 C C 0.0000
866 E C -1.0291
867 V C 0.0000
868 T C -1.1977
869 H C 0.0000
870 Q C -1.7345
871 G C -0.3094
872 L C 0.0942
873 S C -0.3212
874 S C -0.2824
875 P C -0.4648
876 V C 0.0381
877 T C -0.4479
878 K C -0.6151
879 S C -0.7151
880 F C 0.0000
881 N C -2.2962
882 R C -2.4113
883 G C -1.8788
884 E C -1.4715
885 C C -0.8525
886 E D -1.9616
887 V D -0.8822
888 Q D -1.4715
889 L D 0.0000
890 L D -0.0917
891 E D -0.3411
892 S D -0.7402
893 G D -0.9412
894 G D -0.6673
895 G D -0.1010
896 V D 0.3124
897 V D -0.6807
898 Q D -1.9959
899 P D -2.2059
900 G D -2.3338
901 R D -2.8185
902 S D -1.9949
903 L D -1.4972
904 R D -2.1293
905 L D 0.0000
906 S D -0.7095
907 C D 0.0000
908 A D -0.4405
909 A D 0.0000
910 S D -0.9746
911 G D -0.8750
912 F D -0.1215
913 T D -0.0900
914 F D 0.0000
915 S D -0.7097
916 S D 0.2530
917 Y D 0.5220
918 G D 0.2336
919 M D 0.0000
920 H D 0.0000
921 W D 0.0000
922 V D 0.0000
923 R D 0.0000
924 Q D -1.1477
925 A D -1.3693
926 P D -1.0136
927 G D -1.4582
928 K D -2.5583
929 G D -1.9465
930 L D -1.5114
931 E D -2.1702
932 W D 0.0000
933 V D 0.0000
934 A D 0.0000
935 V D 0.0116
936 I D 0.0000
937 S D -0.6210
938 Y D -0.1035
939 D D -1.6755
940 G D -1.5218
941 S D -1.3681
942 N D -1.7366
943 K D -1.0668
944 Y D 0.2920
945 Y D -0.5279
946 A D -1.2888
947 D D -2.5684
948 S D -2.0668
949 V D 0.0000
950 K D -2.5677
951 G D -1.8263
952 R D -1.9408
953 F D 0.0000
954 T D -1.0995
955 I D 0.0000
956 S D -0.7689
957 R D -1.0661
958 D D -1.8950
959 N D -1.8179
960 S D -1.6989
961 K D -2.5156
962 N D -1.9241
963 T D -1.1668
964 L D 0.0000
965 Y D -0.5531
966 L D 0.0000
967 Q D -1.4143
968 M D 0.0000
969 N D -1.9081
970 S D -1.7419
971 L D 0.0000
972 R D -3.0819
973 A D -2.0352
974 E D -2.4624
975 D D 0.0000
976 T D -0.7748
977 A D 0.0000
978 V D 0.0285
979 Y D 0.0000
980 Y D 0.0000
981 C D 0.0000
982 A D 0.0000
983 K D 0.0000
984 D D 0.2848
985 M D 0.7420
986 G D 1.0639
987 W D 1.7563
988 G D 1.2588
989 S D 0.6176
990 G D -0.0574
991 W D 0.3287
992 R D -0.9020
993 P D 0.0275
994 Y D 1.3461
995 Y D 1.6930
996 Y D 1.7849
997 Y D 1.1654
998 G D 0.0000
999 M D 0.0000
1000 D D -0.0422
1001 V D -0.2294
1002 W D 0.0000
1003 G D 0.0000
1004 Q D -1.4497
1005 G D -0.7609
1006 T D -0.4125
1007 T D -0.2401
1008 V D 0.0000
1009 T D -0.2396
1010 V D 0.0000
1011 S D -0.8469
1012 S D -0.6723
1013 A D -0.5980
1014 S D -0.8279
1015 T D -1.0532
1016 K D -1.9884
1017 G D -1.6902
1018 P D -0.8350
1019 S D -0.4185
1020 V D 0.0000
1021 F D -0.5689
1022 P D -1.1919
1023 L D 0.0000
1024 A D 0.0000
1025 P D -0.6756
1026 S D 0.0000
1027 S D -1.2067
1028 K D -2.0154
1029 S D -1.2592
1030 T D -0.9512
1031 S D -0.8414
1032 G D -0.7379
1033 G D -0.6532
1034 T D -0.4580
1035 A D -0.3059
1036 A D 0.0000
1037 L D 0.0000
1038 G D 0.0000
1039 C D 0.0000
1040 L D 0.0000
1041 V D 0.0000
1042 K D -0.3321
1043 D D -0.6725
1044 Y D 0.0000
1045 F D 0.0000
1046 P D 0.0000
1047 E D -0.9370
1048 P D -0.9839
1049 V D -0.9126
1050 T D -0.6237
1051 V D -0.3503
1052 S D -0.3709
1053 W D 0.0000
1054 N D -0.9170
1055 S D -0.7138
1056 G D -0.4210
1057 A D -0.2210
1058 L D 0.0107
1059 T D -0.0999
1060 S D -0.0903
1061 G D -0.1915
1062 V D 0.3392
1063 H D -0.0699
1064 T D 0.0728
1065 F D 0.0000
1066 P D -0.2363
1067 A D 0.2289
1068 V D 0.7590
1069 L D 1.4354
1070 Q D 0.1689
1071 S D -0.0324
1072 S D -0.3002
1073 G D 0.0000
1074 L D 0.0604
1075 Y D 0.2566
1076 S D 0.1791
1077 L D 0.0816
1078 S D 0.0000
1079 S D 0.0000
1080 V D 0.0000
1081 V D 0.0000
1082 T D -0.0389
1083 V D 0.0000
1084 P D -0.5026
1085 S D -0.5374
1086 S D -0.6357
1087 S D -0.7473
1088 L D -0.8897
1089 G D -1.1724
1090 T D -0.9074
1091 Q D -1.3754
1092 T D -1.2962
1093 Y D 0.0000
1094 I D -1.2797
1095 C D 0.0000
1096 N D -1.5883
1097 V D 0.0000
1098 N D -2.0543
1099 H D 0.0000
1100 K D -2.7702
1101 P D -1.7349
1102 S D -1.9780
1103 N D -2.5172
1104 T D -2.1328
1105 K D -2.6210
1106 V D -1.7267
1107 D D -2.5892
1108 K D -2.1539
1109 K D -2.6622
1110 V D 0.0000
1111 E D -2.5975
1112 P D -1.6340
1113 K D -1.4024
1114 S D -1.3067
1115 C D -0.9688
1116 D D -1.5821
1117 K D -1.7447
1118 T D -1.2957
1119 H D -1.4307
1120 T D -1.2693
1121 C D -1.3515
1122 P D -0.9163
1123 P D -0.7443
1124 C D -0.2993
1125 P D -0.6166
1126 A D -0.8407
1127 P D -1.0819
1128 E D -1.3689
1129 L D 0.2839
1130 L D 1.2381
1131 G D 0.0301
1132 G D -0.0229
1133 P D 0.0196
1134 S D 0.3483
1135 V D 0.9228
1136 F D 2.0389
1137 L D 0.0000
1138 F D 2.0014
1139 P D 0.4209
1140 P D 0.0000
1141 K D -1.8373
1142 P D -1.2339
1143 K D -0.9837
1144 D D 0.0000
1145 T D 0.0000
1146 L D 0.0000
1147 M D 0.5295
1148 I D 1.3598
1149 S D -0.0889
1150 R D -1.2687
1151 T D -0.6152
1152 P D 0.0000
1153 E D -0.7460
1154 V D 0.0000
1155 T D 0.9963
1156 C D 0.0000
1157 V D 0.9481
1158 V D 0.0000
1159 V D 0.4294
1160 D D 0.0193
1161 V D 0.0000
1162 S D -1.7598
1163 H D -2.4370
1164 E D -2.8972
1165 D D -2.4505
1166 P D -2.7308
1167 E D -3.3368
1168 V D 0.0000
1169 K D -2.7717
1170 F D 0.0000
1171 N D -1.6160
1172 W D 0.0000
1173 Y D -1.2759
1174 V D -0.9369
1175 D D -2.1311
1176 G D -0.8374
1177 V D 0.6241
1178 E D -0.7780
1179 V D 0.2627
1180 H D -1.1693
1181 N D -1.1283
1182 A D -1.0372
1183 K D -2.2557
1184 T D -1.4601
1185 K D -2.3423
1186 P D -2.2174
1187 R D -3.3752
1188 E D -3.3415
1189 E D -2.4496
1190 Q D -1.9721
1191 Y D -0.8004
1192 N D -1.0520
1193 S D -0.8252
1194 T D -0.8300
1195 Y D 0.0000
1196 R D -1.5214
1197 V D 0.0000
1198 V D -0.7761
1199 S D 0.0000
1200 V D 0.1429
1201 L D 0.0000
1202 T D -0.2428
1203 V D 0.4975
1204 L D 1.0981
1205 H D -0.0230
1206 Q D -0.9506
1207 D D -0.9515
1208 W D -0.8371
1209 L D -0.8060
1210 N D -1.9160
1211 G D -2.0420
1212 K D -2.2110
1213 E D -2.4451
1214 Y D 0.0000
1215 K D -2.1811
1216 C D 0.0000
1217 K D -1.8205
1218 V D 0.0000
1219 S D -1.4378
1220 N D -1.8932
1221 K D -2.0853
1222 A D -1.2959
1223 L D -0.5644
1224 P D -0.4505
1225 A D -0.2429
1226 P D -0.3400
1227 I D -0.3016
1228 E D -1.6379
1229 K D -1.8080
1230 T D -1.5050
1231 I D -0.3546
1232 S D -1.7803
1233 K D -1.7162
1234 A D -1.4988
1235 K D -2.4429
1236 G D -2.1903
1237 Q D -2.2568
1238 P D -2.3444
1239 R D -2.9079
1240 E D -2.4201
1241 P D 0.0000
1242 Q D -1.0139
1243 V D 0.0000
1244 Y D -0.7836
1245 T D 0.0000
1246 L D 0.0000
1247 P D -0.5311
1248 P D 0.0000
1249 S D -1.3866
1250 R D -2.5595
1251 D D -2.7468
1252 E D 0.0000
1253 L D -1.3100
1254 T D -1.4570
1255 K D -2.4204
1256 N D -2.5649
1257 Q D -2.3008
1258 V D 0.0000
1259 S D -0.2644
1260 L D 0.0000
1261 T D 0.0000
1262 C D 0.0000
1263 L D 0.0000
1264 V D 0.0000
1265 K D 0.0000
1266 G D -0.9620
1267 F D 0.0000
1268 Y D -1.3472
1269 P D 0.0000
1270 S D -0.0285
1271 D D -0.8871
1272 I D 0.0000
1273 A D -0.4166
1274 V D 0.0000
1275 E D -1.0385
1276 W D 0.0000
1277 E D -1.7435
1278 S D 0.0000
1279 N D -1.8177
1280 G D -1.7247
1281 Q D -2.1531
1282 P D -1.9366
1283 E D -2.1656
1284 N D -2.0355
1285 N D -1.5961
1286 Y D -0.9375
1287 K D -0.4977
1288 T D -0.3212
1289 T D 0.0000
1290 P D 0.0274
1291 P D 0.3010
1292 V D 0.7952
1293 L D 0.9363
1294 D D -0.4056
1295 S D -1.3273
1296 D D -1.9900
1297 G D -0.9064
1298 S D 0.0000
1299 F D 0.1716
1300 F D 0.0000
1301 L D 0.0000
1302 Y D 0.0000
1303 S D 0.0000
1304 K D 0.0000
1305 L D 0.0000
1306 T D 0.0000
1307 V D 0.0000
1308 D D -2.4540
1309 K D -2.3582
1310 S D -2.0448
1311 R D -2.3069
1312 W D 0.0000
1313 Q D -2.7129
1314 Q D -2.5709
1315 G D -1.6573
1316 N D -1.2877
1317 V D -0.4943
1318 F D 0.0000
1319 S D -1.0504
1320 C D 0.0000
1321 S D -0.6074
1322 V D 0.0000
1323 M D -0.3551
1324 H D 0.0000
1325 E D -1.1678
1326 A D -1.8415
1327 L D 0.0000
1328 H D -1.6225
1329 N D -1.5720
1330 H D -0.7140
1331 Y D -0.0324
1332 T D -0.6674
1333 Q D -1.0621
1334 K D -1.1112
1335 S D -0.4209
1336 L D 0.0000
1337 S D -0.1833
1338 L D 0.8847
1339 S D -0.0958
1340 P D -0.5907
1341 G D -0.8135
1342 K D -1.5344

 

Laboratory of Theory of Biopolymers 2015