Project name: bf1ece8a9cf1f20

Status: done

submitted: 2018-03-13 10:59:47, status changed: 2018-03-13 11:35:26
Settings
Chain sequence(s) A: QVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWTWIRQPPGKGLEWIGSYYDSSGYPNAFDIRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTPLGGIAVAGMVSDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: DIVLTQPPSVSGAPGQRVTISCGFTFSYSAMHYQQLPGTAPKLLIYDEAGGGSGWYVGYYYYGMDVVPDRFSGSKSGTSASLAITGLQSEDEADYYCSPSWIQLWCHLDVGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWTWIRQPPGKGLEWIGSYYDSSGYPNAFDIRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTPLGGIAVAGMVSDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: DIVLTQPPSVSGAPGQRVTISCGFTFSYSAMHYQQLPGTAPKLLIYDEAGGGSGWYVGYYYYGMDVVPDRFSGSKSGTSASLAITGLQSEDEADYYCSPSWIQLWCHLDVGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1644
Maximal score value
2.5944
Average score
-0.668
Total score value
-903.1986

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.7186
2 V A -1.3547
3 Q A -1.8710
4 L A 0.0000
5 Q A -1.9586
6 E A -1.2967
7 S A -0.7879
8 G A -0.7270
9 P A 0.1181
10 G A 0.1993
11 L A 0.2359
12 V A 0.0000
13 K A -2.1495
14 P A -1.5198
15 S A -1.4412
16 E A -1.9121
17 T A -1.2640
18 L A 0.0000
19 S A -0.5663
20 L A 0.0000
21 T A -0.6044
22 C A 0.0000
23 T A -1.3449
24 V A 0.0000
25 S A -1.3907
26 G A -1.3869
27 G A -0.9286
28 S A -0.4909
29 I A -0.5176
30 S A 0.0894
31 S A 0.3268
32 Y A 0.5586
33 F A 0.0000
34 W A 0.0000
35 T A 0.0000
36 W A 0.0000
37 I A 0.0000
38 R A 0.0000
39 Q A -0.7293
40 P A 0.0000
41 P A -1.0238
42 G A -1.4812
43 K A -2.2897
44 G A -1.4131
45 L A -0.7758
46 E A -0.7045
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 S A 0.0000
51 Y A 0.8876
52 Y A 0.8360
53 D A -1.0203
54 S A -0.1090
55 S A -0.3176
56 G A -0.5454
57 Y A -0.8019
58 P A 0.0000
59 N A -1.4979
60 A A -0.6425
61 F A 0.0000
62 D A -1.1018
63 I A 0.8020
64 R A -0.2758
65 V A 0.0000
66 T A -0.3735
67 I A 0.0000
68 S A -0.7372
69 V A -0.8473
70 D A -1.6764
71 T A -1.2032
72 S A -1.4268
73 K A -2.3568
74 N A -1.8733
75 Q A -1.5598
76 F A 0.0000
77 S A -0.5111
78 L A 0.0000
79 K A -0.8112
80 L A 0.0000
81 S A -0.6339
82 S A -1.0269
83 V A 0.0000
84 T A -0.6708
85 A A -0.3184
86 A A 0.0224
87 D A 0.0000
88 T A 0.3596
89 A A 0.0000
90 V A 0.6798
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 A A 0.0000
95 R A 0.0000
96 T A 0.0000
97 P A 0.9368
98 L A 1.0434
99 G A 0.3071
100 G A 0.1760
101 I A 0.8287
102 A A 0.0000
103 V A 0.0000
104 A A 0.0000
105 G A 0.0000
106 M A 1.4689
107 V A 1.6218
108 S A 0.0000
109 D A 0.0000
110 Y A -0.3539
111 W A 0.0000
112 G A 0.0000
113 Q A -1.4107
114 G A 0.0000
115 T A 0.0000
116 L A 1.3640
117 V A 0.0000
118 T A 0.2294
119 V A 0.0000
120 S A -0.8197
121 S A -0.8198
122 A A -0.7002
123 S A -0.6737
124 T A -0.7752
125 K A -1.3350
126 G A -1.3178
127 P A -0.5080
128 S A 0.0218
129 V A -0.1952
130 F A -0.1925
131 P A -0.8344
132 L A 0.0000
133 A A -1.1247
134 P A 0.0000
135 S A -1.4113
136 S A -1.2993
137 K A -2.0113
138 S A -1.3614
139 T A -1.1007
140 S A -0.9058
141 G A -0.8611
142 G A -0.9237
143 T A -0.8089
144 A A -0.5905
145 A A 0.0000
146 L A 0.0000
147 G A 0.0000
148 C A 0.0000
149 L A 0.0000
150 V A 0.0000
151 K A 0.0000
152 D A -0.2310
153 Y A 0.0000
154 F A 0.0000
155 P A -0.6739
156 E A -0.7939
157 P A -0.8236
158 V A -0.6941
159 T A -0.5327
160 V A -0.1432
161 S A -0.3336
162 W A 0.0000
163 N A -0.5932
164 S A -0.6168
165 G A -0.5885
166 A A -0.2693
167 L A -0.0231
168 T A -0.2026
169 S A -0.1850
170 G A -0.2371
171 V A 0.1131
172 H A 0.0000
173 T A 0.0187
174 F A 0.0000
175 P A -0.2013
176 A A 0.0472
177 V A 0.4871
178 L A 1.0036
179 Q A 0.0688
180 S A -0.2540
181 S A -0.3079
182 G A -0.0879
183 L A -0.0261
184 Y A 0.3905
185 S A 0.0000
186 L A 0.0000
187 S A 0.0000
188 S A 0.0000
189 V A 0.0000
190 V A 0.0000
191 T A -0.1574
192 V A 0.0000
193 P A -0.5406
194 S A -0.6746
195 S A -0.5479
196 S A -0.6518
197 L A -0.8286
198 G A -1.0240
199 T A -0.8205
200 Q A -1.3856
201 T A -1.0319
202 Y A 0.0000
203 I A -0.8429
204 C A 0.0000
205 N A -1.1397
206 V A 0.0000
207 N A -1.7024
208 H A 0.0000
209 K A -2.7758
210 P A -1.7658
211 S A -1.9611
212 N A -2.6128
213 T A -2.0511
214 K A -2.4641
215 V A -1.1238
216 D A -1.8043
217 K A -1.4199
218 K A -1.6724
219 A A 0.0000
220 E A -2.7336
221 P A -1.9753
222 K A -2.3815
223 S A -1.9452
224 C A -1.4893
225 D A -2.5709
226 K A -3.1143
227 T A -2.2605
228 H A -2.3649
229 T A 0.0000
230 C A -0.3710
231 P A -0.7169
232 P A -0.2868
233 C A 0.2422
234 P A -0.5510
235 A A -1.1075
236 P A -1.3990
237 E A -1.7281
238 L A 0.4995
239 L A 1.3217
240 G A 0.2434
241 G A -0.1698
242 P A 0.0000
243 S A 0.0810
244 V A 0.0000
245 F A 0.8492
246 L A 0.7191
247 F A 0.9022
248 P A -0.2246
249 P A 0.0000
250 K A -2.3072
251 P A -1.3199
252 K A -1.0776
253 D A 0.0000
254 T A 0.0000
255 L A 0.0000
256 M A 0.3107
257 I A 1.2816
258 S A -0.1502
259 R A -1.7327
260 T A -1.0013
261 P A 0.0000
262 E A -1.6520
263 V A 0.0000
264 T A 0.2643
265 C A 0.0000
266 V A 0.0000
267 V A 0.0000
268 V A -0.8180
269 D A -0.8709
270 V A 0.0000
271 S A -1.5042
272 H A -1.9638
273 E A -2.5662
274 D A -2.0696
275 P A -2.2807
276 E A -2.8635
277 V A -1.9917
278 K A -2.0676
279 F A -1.4144
280 N A -1.6473
281 W A 0.0000
282 Y A -1.2739
283 V A -1.1402
284 D A -2.3381
285 G A -1.0836
286 V A 0.2030
287 E A -1.5054
288 V A -0.9237
289 H A -2.0853
290 N A -2.2210
291 A A -1.8622
292 K A -2.4555
293 T A -1.9127
294 K A -2.5045
295 P A -2.4268
296 R A -3.8322
297 E A -4.1644
298 E A -3.5504
299 Q A -2.1362
300 Y A -0.0271
301 N A -1.1483
302 S A -1.0968
303 T A -1.5917
304 Y A -2.6191
305 R A -2.8943
306 V A 0.0000
307 V A -1.2379
308 S A 0.0000
309 V A 0.0000
310 L A 0.0000
311 T A -0.9456
312 V A 0.0000
313 L A -0.1183
314 H A -0.7015
315 Q A -1.5963
316 D A -1.7108
317 W A 0.0000
318 L A -1.1267
319 N A -2.1197
320 G A -2.0243
321 K A -2.3036
322 E A -2.2041
323 Y A 0.0000
324 K A -1.8382
325 C A 0.0000
326 K A -1.7809
327 V A 0.0000
328 S A -1.4220
329 N A 0.0000
330 K A -2.2252
331 A A -1.4828
332 L A -0.4994
333 P A -0.4918
334 A A -0.5137
335 P A -0.8424
336 I A -0.6794
337 E A -2.0110
338 K A -1.4126
339 T A -1.1491
340 I A -0.2554
341 S A -1.0789
342 K A 0.0000
343 A A -0.8951
344 K A -2.1863
345 G A -1.9226
346 Q A -2.2924
347 P A -2.2948
348 R A -3.0242
349 E A -3.1098
350 P A 0.0000
351 Q A -1.2100
352 V A 0.0000
353 Y A 0.0000
354 T A -0.6922
355 L A 0.0000
356 P A -0.4380
357 P A -0.9314
358 S A -1.5343
359 R A -2.8161
360 D A -2.8413
361 E A 0.0000
362 L A -1.9762
363 T A -1.7844
364 K A -2.6593
365 N A -2.7006
366 Q A -2.5850
367 V A 0.0000
368 S A 0.0000
369 L A 0.0000
370 T A 0.0000
371 C A 0.0000
372 L A 0.0000
373 V A 0.0000
374 K A -0.8492
375 G A -1.3721
376 F A 0.0000
377 Y A -1.3695
378 P A 0.0000
379 S A -0.2848
380 D A -0.8872
381 I A 0.0000
382 A A -0.4901
383 V A -0.1922
384 E A -0.7959
385 W A 0.0000
386 E A -1.5217
387 S A 0.0000
388 N A -1.7774
389 G A -1.8479
390 Q A -2.2599
391 P A -1.9245
392 E A -1.9042
393 N A -2.3146
394 N A -2.0870
395 Y A -1.2151
396 K A -1.1008
397 T A -0.3454
398 T A 0.0000
399 P A -0.2159
400 P A -0.0156
401 V A 0.0000
402 L A 0.4373
403 D A -0.7774
404 S A -1.2844
405 D A -1.9099
406 G A -1.0936
407 S A 0.0000
408 F A -0.1544
409 F A 0.0000
410 L A 0.0000
411 Y A 0.0000
412 S A 0.0000
413 K A 0.0000
414 L A 0.0000
415 T A -1.1305
416 V A 0.0000
417 D A -2.5461
418 K A -2.5891
419 S A -2.1281
420 R A -1.8897
421 W A 0.0000
422 Q A -2.2903
423 Q A -2.2471
424 G A -1.3682
425 N A -0.4392
426 V A 0.7128
427 F A 0.0000
428 S A -0.6881
429 C A 0.0000
430 S A 0.0000
431 V A 0.0000
432 M A 0.0000
433 H A 0.0000
434 E A -1.3259
435 A A -1.9186
436 L A 0.0000
437 H A -1.9363
438 N A -1.8516
439 H A -1.4463
440 Y A -0.6849
441 T A -0.9161
442 Q A -1.3345
443 K A -1.2208
444 S A -0.4843
445 L A 0.0000
446 S A 0.0701
447 L A -0.4550
448 S A -0.9537
449 P A -1.1693
450 G A -1.8239
451 K A -2.4112
452 Q B -1.5335
453 V B -1.1053
454 Q B -1.4353
455 L B 0.0000
456 Q B -1.8851
457 E B -1.4308
458 S B -0.9025
459 G B -0.7528
460 P B -0.2004
461 G B 0.0406
462 L B 0.1564
463 V B -0.4733
464 K B -1.3106
465 P B -1.1444
466 S B -1.2062
467 E B -1.6558
468 T B -1.1530
469 L B 0.0000
470 S B -0.7174
471 L B 0.0000
472 T B -0.6037
473 C B 0.0000
474 T B -1.3272
475 V B 0.0000
476 S B -1.2721
477 G B -1.2744
478 G B -1.0801
479 S B -0.6142
480 I B 0.0000
481 S B -0.1729
482 S B 0.2409
483 Y B 0.4072
484 F B 0.0000
485 W B 0.0000
486 T B 0.0000
487 W B 0.0000
488 I B 0.0000
489 R B -0.4054
490 Q B -0.7904
491 P B 0.0000
492 P B -1.0795
493 G B -1.5383
494 K B -2.2576
495 G B -1.2867
496 L B 0.0000
497 E B -0.5086
498 W B 0.0000
499 I B 0.0000
500 G B 0.0000
501 S B 0.0000
502 Y B 0.7364
503 Y B 0.7043
504 D B -1.0710
505 S B -0.2668
506 S B -0.4375
507 G B -0.3990
508 Y B -0.6931
509 P B 0.0000
510 N B -1.6073
511 A B -0.8622
512 F B 0.0000
513 D B -1.3563
514 I B 0.6380
515 R B -0.3387
516 V B 0.0000
517 T B -0.4615
518 I B -0.5612
519 S B -0.7549
520 V B -1.1018
521 D B -2.2211
522 T B -1.4985
523 S B -1.6420
524 K B -2.5788
525 N B -2.0234
526 Q B -1.6525
527 F B 0.0000
528 S B -0.5166
529 L B 0.0000
530 K B -1.2041
531 L B 0.0000
532 S B -0.7689
533 S B -0.7672
534 V B 0.0000
535 T B -0.4962
536 A B -0.1369
537 A B 0.0250
538 D B 0.0000
539 T B 0.1952
540 A B 0.0000
541 V B 0.3360
542 Y B 0.0000
543 Y B 0.0000
544 C B 0.0000
545 A B 0.0000
546 R B 0.0000
547 T B 0.0000
548 P B 0.7241
549 L B 0.9759
550 G B 0.9989
551 G B 0.6223
552 I B 1.6242
553 A B 0.0000
554 V B 0.0000
555 A B 0.0000
556 G B 0.0000
557 M B 1.1257
558 V B 1.2991
559 S B 0.3583
560 D B -0.1290
561 Y B 0.0044
562 W B 0.0000
563 G B 0.0000
564 Q B -1.4353
565 G B -0.8671
566 T B 0.0000
567 L B 0.5353
568 V B 0.0000
569 T B 0.1591
570 V B 0.0000
571 S B -0.5390
572 S B -0.5516
573 A B -0.6002
574 S B -0.6621
575 T B -0.9962
576 K B -1.6280
577 G B -1.5481
578 P B 0.0000
579 S B -0.5117
580 V B 0.0000
581 F B -0.4757
582 P B -0.7904
583 L B 0.0000
584 A B -1.0213
585 P B 0.0000
586 S B -0.9217
587 S B -1.2075
588 K B -1.1729
589 S B -0.6270
590 T B -0.6926
591 S B -0.9455
592 G B -1.2426
593 G B -1.0213
594 T B -0.5118
595 A B -0.4510
596 A B -0.1318
597 L B 0.0000
598 G B 0.0000
599 C B 0.0000
600 L B 0.0000
601 V B 0.0000
602 K B -0.4041
603 D B -0.5395
604 Y B 0.0000
605 F B 0.0000
606 P B 0.0000
607 E B -0.9142
608 P B -0.9000
609 V B -0.7627
610 T B -0.6540
611 V B -0.3458
612 S B -0.4113
613 W B 0.0000
614 N B -0.7105
615 S B -0.6793
616 G B -0.6018
617 A B -0.2649
618 L B 0.0173
619 T B -0.1872
620 S B -0.2060
621 G B -0.2891
622 V B 0.1024
623 H B -0.1540
624 T B -0.0384
625 F B 0.0000
626 P B -0.3482
627 A B 0.0637
628 V B 0.7448
629 L B 1.5317
630 Q B 0.3665
631 S B -0.0734
632 S B -0.2307
633 G B -0.0371
634 L B 0.0000
635 Y B 0.3833
636 S B 0.0000
637 L B 0.0000
638 S B 0.0000
639 S B 0.0000
640 V B 0.0000
641 V B 0.0000
642 T B -0.2404
643 V B 0.0000
644 P B -0.4238
645 S B -0.4931
646 S B -0.7135
647 S B -0.8135
648 L B -1.2189
649 G B -1.7767
650 T B -1.0284
651 Q B -1.5541
652 T B -1.2674
653 Y B 0.0000
654 I B -1.0694
655 C B 0.0000
656 N B -1.3339
657 V B 0.0000
658 N B -1.8925
659 H B 0.0000
660 K B -2.7850
661 P B -1.7590
662 S B -2.0656
663 N B -2.6897
664 T B -2.0735
665 K B -2.5552
666 V B -1.1091
667 D B -2.0908
668 K B -1.7639
669 K B -2.0875
670 A B 0.0000
671 E B -2.6722
672 P B -2.1122
673 K B -2.2756
674 S B -1.6986
675 C B -1.3883
676 D B -2.2150
677 K B -2.8696
678 T B -2.2090
679 H B -1.7272
680 T B -0.9061
681 C B -0.1450
682 P B -0.1916
683 P B 0.0282
684 C B 0.2701
685 P B -0.4872
686 A B -0.5656
687 P B -0.8161
688 E B -1.0834
689 L B 1.2051
690 L B 1.0845
691 G B 0.2221
692 G B -0.5569
693 P B 0.0000
694 S B -0.3195
695 V B 0.0000
696 F B 0.8239
697 L B 0.6838
698 F B 1.0709
699 P B -0.1400
700 P B 0.0000
701 K B -2.3662
702 P B -1.5336
703 K B -1.5221
704 D B -1.5293
705 T B 0.0000
706 L B -0.4193
707 M B 0.4727
708 I B 1.3876
709 S B -0.0372
710 R B -1.6992
711 T B -0.8509
712 P B 0.0000
713 E B -0.8881
714 V B 0.0000
715 T B 0.3074
716 C B 0.0000
717 V B 0.0000
718 V B 0.0000
719 V B -1.0013
720 D B -2.0776
721 V B 0.0000
722 S B -1.5980
723 H B -1.5929
724 E B -1.4028
725 D B -1.4593
726 P B -1.8314
727 E B -2.6112
728 V B -1.8059
729 K B -2.1713
730 F B -1.0905
731 N B -1.3318
732 W B 0.0000
733 Y B -0.9675
734 V B -1.0415
735 D B -2.0297
736 G B -0.9721
737 V B 0.3785
738 E B -1.3442
739 V B -0.7284
740 H B -1.6887
741 N B -1.4533
742 A B -1.2971
743 K B -2.2615
744 T B -1.8701
745 K B -2.6269
746 P B -2.3353
747 R B -3.0275
748 E B -3.5279
749 E B -3.2549
750 Q B -2.0714
751 Y B -0.1908
752 N B -1.3259
753 S B -1.2636
754 T B -1.9841
755 Y B -2.5485
756 R B -2.6522
757 V B 0.0000
758 V B -0.9404
759 S B 0.0000
760 V B -0.6850
761 L B 0.0000
762 T B -0.3512
763 V B 0.0000
764 L B 0.7054
765 H B -0.0987
766 Q B -1.2018
767 D B -1.0972
768 W B 0.0000
769 L B -0.9415
770 N B -1.9993
771 G B -2.0376
772 K B -2.2227
773 E B -2.4406
774 Y B 0.0000
775 K B -1.9332
776 C B 0.0000
777 K B -1.6698
778 V B 0.0000
779 S B -1.4423
780 N B 0.0000
781 K B -2.2648
782 A B 0.0000
783 L B 0.0000
784 P B -0.5767
785 A B -0.5934
786 P B -0.8986
787 I B -0.8623
788 E B -2.2611
789 K B -1.5668
790 T B -1.2360
791 I B -0.3651
792 S B -1.0974
793 K B -1.3127
794 A B -1.2120
795 K B -2.3324
796 G B -2.1113
797 Q B -2.3651
798 P B -2.2216
799 R B -2.7567
800 E B -2.6714
801 P B 0.0000
802 Q B -1.0344
803 V B -0.6923
804 Y B 0.0000
805 T B 0.0000
806 L B 0.0000
807 P B -0.4149
808 P B -0.6955
809 S B -1.1313
810 R B -2.0650
811 D B -1.6172
812 E B 0.0000
813 L B -1.4657
814 T B -1.4062
815 K B -2.3165
816 N B -2.7481
817 Q B -2.6842
818 V B 0.0000
819 S B 0.0000
820 L B 0.0000
821 T B 0.0000
822 C B 0.0000
823 L B 0.0000
824 V B 0.0000
825 K B -0.4995
826 G B -1.1268
827 F B 0.0000
828 Y B -1.3775
829 P B 0.0000
830 S B -0.3960
831 D B -1.2231
832 I B -0.6882
833 A B 0.0000
834 V B -0.3894
835 E B -0.9932
836 W B 0.0000
837 E B -1.6450
838 S B 0.0000
839 N B -1.8480
840 G B -1.8646
841 Q B -2.2890
842 P B -1.9570
843 E B -1.9425
844 N B -2.2566
845 N B -1.9002
846 Y B -1.1308
847 K B -1.0153
848 T B -0.3561
849 T B 0.0000
850 P B -0.2785
851 P B -0.0242
852 V B 0.0000
853 L B 0.5437
854 D B -0.6916
855 S B -1.3081
856 D B -1.8950
857 G B -0.9007
858 S B 0.0000
859 F B -0.0611
860 F B 0.0000
861 L B 0.0000
862 Y B 0.0000
863 S B 0.0000
864 K B 0.0000
865 L B 0.0000
866 T B -1.1336
867 V B 0.0000
868 D B -2.7478
869 K B -2.6926
870 S B -2.3152
871 R B -2.0972
872 W B 0.0000
873 Q B -2.3146
874 Q B -2.0832
875 G B -1.0782
876 N B -0.6550
877 V B 0.5041
878 F B 0.0000
879 S B -0.7331
880 C B 0.0000
881 S B 0.0000
882 V B 0.0000
883 M B -0.5751
884 H B 0.0000
885 E B -1.2830
886 A B -1.8177
887 L B 0.0000
888 H B -1.9760
889 N B -1.9089
890 H B -1.4709
891 Y B -0.6419
892 T B -0.8743
893 Q B -1.2321
894 K B -0.9671
895 S B -0.4153
896 L B 0.0000
897 S B -0.0025
898 L B -0.2368
899 S B -0.4292
900 P B -0.8476
901 G B -1.4262
902 K B -2.0918
903 D C -1.0693
904 I C 0.0000
905 V C 0.9077
906 L C 0.0000
907 T C -0.1677
908 Q C -0.4621
909 P C -0.7264
910 P C -0.7290
911 S C -0.8925
912 V C -0.5599
913 S C -0.5810
914 G C 0.0000
915 A C -0.8466
916 P C -1.6010
917 G C -1.7995
918 Q C -2.5632
919 R C -2.7422
920 V C 0.0000
921 T C -0.6472
922 I C 0.0000
923 S C -0.3980
924 C C 0.0000
925 G C -0.0386
926 F C 0.0000
927 T C 0.7883
928 F C 1.5980
929 S C 0.4824
930 Y C 0.0000
931 S C -0.0484
932 A C 0.1630
933 M C 0.0000
934 H C 0.0000
935 Y C 0.0000
936 Q C -0.5680
937 Q C -0.6059
938 L C -0.0461
939 P C -0.1669
940 G C -0.6298
941 T C -0.5896
942 A C -0.7812
943 P C 0.0000
944 K C -1.4523
945 L C 0.0000
946 L C 0.0000
947 I C 0.0000
948 Y C 0.5404
949 D C -0.1084
950 E C -0.6323
951 A C -0.0680
952 G C -1.0149
953 G C -0.3421
954 G C -0.3108
955 S C 0.2103
956 G C 0.6719
957 W C 1.9131
958 Y C 2.3541
959 V C 2.5944
960 G C 1.4495
961 Y C 2.3147
962 Y C 2.2673
963 Y C 1.6516
964 Y C 1.5239
965 G C 0.0000
966 M C 0.5006
967 D C 0.5719
968 V C 0.5606
969 V C -0.1651
970 P C -0.9660
971 D C -1.9028
972 R C -1.5678
973 F C 0.0000
974 S C -0.5291
975 G C 0.0000
976 S C -0.3259
977 K C -0.5589
978 S C -0.5514
979 G C -0.2279
980 T C -0.0046
981 S C -0.3990
982 A C -0.4210
983 S C -0.3785
984 L C 0.0000
985 A C -0.6021
986 I C 0.0000
987 T C -1.6038
988 G C -1.7415
989 L C 0.0000
990 Q C -2.1565
991 S C -1.7741
992 E C -2.3198
993 D C 0.0000
994 E C -1.7360
995 A C 0.0000
996 D C -0.9483
997 Y C 0.0000
998 Y C -0.3270
999 C C 0.0000
1000 S C 0.0000
1001 P C 0.0000
1002 S C 0.0000
1003 W C 1.2643
1004 I C 1.7577
1005 Q C 0.0186
1006 L C 0.3298
1007 W C 0.0000
1008 C C 0.0000
1009 H C -0.7977
1010 L C 0.0838
1011 D C -0.9752
1012 V C 0.0000
1013 G C 0.0000
1014 G C -0.9497
1015 G C -0.8997
1016 T C 0.0000
1017 K C -2.0140
1018 L C 0.0000
1019 T C -0.6671
1020 V C -0.0937
1021 L C -0.5772
1022 G C -1.4522
1023 Q C -2.3106
1024 P C -2.2313
1025 K C -2.5512
1026 A C -1.7583
1027 A C -1.1873
1028 P C -0.6545
1029 S C -0.3701
1030 V C 0.0000
1031 T C -0.6681
1032 L C 0.0000
1033 F C 0.0000
1034 P C -0.0985
1035 P C -0.4100
1036 S C -0.9628
1037 S C -1.4514
1038 E C -2.2475
1039 E C 0.0000
1040 L C -1.7359
1041 Q C -2.1089
1042 A C -1.5115
1043 N C -2.3294
1044 K C -1.5272
1045 A C 0.0000
1046 T C 0.0000
1047 L C 0.0000
1048 V C 0.0000
1049 C C 0.0000
1050 L C 0.0000
1051 I C 0.0000
1052 S C 0.0000
1053 D C -1.1344
1054 F C 0.0000
1055 Y C 0.0000
1056 P C -1.2263
1057 G C -0.5942
1058 A C -0.1766
1059 V C 0.0085
1060 T C -0.0277
1061 V C -0.1501
1062 A C -0.4794
1063 W C 0.0000
1064 K C -1.2573
1065 A C 0.0000
1066 D C -1.5054
1067 S C -0.9653
1068 S C -0.7122
1069 P C -0.4549
1070 V C -0.3448
1071 K C -0.9774
1072 A C -0.4146
1073 G C -0.7195
1074 V C -0.3016
1075 E C -1.5137
1076 T C 0.0000
1077 T C -0.4814
1078 T C -0.3835
1079 P C -0.7229
1080 S C -1.1999
1081 K C -1.9980
1082 Q C -2.0890
1083 S C -1.7404
1084 N C -2.0390
1085 N C -1.5843
1086 K C -1.6300
1087 Y C -0.7487
1088 A C 0.0000
1089 A C 0.0000
1090 S C 0.0000
1091 S C 0.0000
1092 Y C 0.0000
1093 L C 0.0000
1094 S C -0.2012
1095 L C -0.8435
1096 T C -1.6109
1097 P C -2.3191
1098 E C -3.0410
1099 Q C -2.3406
1100 W C 0.0000
1101 K C -3.0627
1102 S C -2.3313
1103 H C -2.3990
1104 R C -2.7433
1105 S C -1.4351
1106 Y C 0.0000
1107 S C -1.1963
1108 C C 0.0000
1109 Q C -1.0893
1110 V C 0.0000
1111 T C -0.5978
1112 H C -1.0015
1113 E C -2.4788
1114 G C -1.6052
1115 S C -0.7680
1116 T C -0.6415
1117 V C -0.7366
1118 E C -2.1203
1119 K C -1.7122
1120 T C -0.9736
1121 V C -0.6465
1122 A C -1.1672
1123 P C -1.6255
1124 T C -1.4338
1125 E C -1.9866
1126 C C -1.4491
1127 S C -1.0194
1128 D D -1.0949
1129 I D 0.0000
1130 V D 0.8179
1131 L D 0.0000
1132 T D -0.2871
1133 Q D -0.5041
1134 P D -0.6560
1135 P D -0.6321
1136 S D -0.6767
1137 V D -0.4293
1138 S D -0.4636
1139 G D -0.9893
1140 A D 0.0000
1141 P D -1.8831
1142 G D -1.9106
1143 Q D -2.6027
1144 R D -2.7757
1145 V D 0.0000
1146 T D -0.6789
1147 I D 0.0000
1148 S D -0.3970
1149 C D 0.0000
1150 G D -0.1262
1151 F D 0.0000
1152 T D 0.6644
1153 F D 1.5554
1154 S D 0.4962
1155 Y D 0.0000
1156 S D 0.0221
1157 A D 0.3355
1158 M D 0.0000
1159 H D 0.0000
1160 Y D 0.0000
1161 Q D 0.0000
1162 Q D -0.6453
1163 L D -0.1788
1164 P D -0.2105
1165 G D -0.6032
1166 T D -0.6291
1167 A D -0.8210
1168 P D 0.0000
1169 K D -1.4111
1170 L D 0.0000
1171 L D 0.0000
1172 I D 0.0000
1173 Y D 0.0000
1174 D D 0.0000
1175 E D -0.8946
1176 A D -0.1959
1177 G D 0.3569
1178 G D 0.0647
1179 G D -0.3327
1180 S D -0.3994
1181 G D 0.1608
1182 W D 1.4265
1183 Y D 1.4401
1184 V D 2.1754
1185 G D 1.1791
1186 Y D 1.7856
1187 Y D 1.2550
1188 Y D 1.0998
1189 Y D 0.9310
1190 G D 0.0000
1191 M D 0.2543
1192 D D 0.0000
1193 V D 0.0091
1194 V D -0.3821
1195 P D -1.1316
1196 D D -2.3475
1197 R D -2.4428
1198 F D 0.0000
1199 S D -0.6732
1200 G D 0.0000
1201 S D -0.2548
1202 K D -0.5096
1203 S D -0.5880
1204 G D -0.1651
1205 T D 0.0342
1206 S D -0.3676
1207 A D 0.0000
1208 S D -0.3834
1209 L D 0.0000
1210 A D -0.7193
1211 I D 0.0000
1212 T D -1.8271
1213 G D -2.0411
1214 L D 0.0000
1215 Q D -2.0136
1216 S D -1.8870
1217 E D -2.4418
1218 D D 0.0000
1219 E D -1.7080
1220 A D -0.9317
1221 D D -0.8119
1222 Y D 0.0000
1223 Y D -0.3280
1224 C D 0.0000
1225 S D 0.0000
1226 P D 0.0000
1227 S D 0.0000
1228 W D 1.2595
1229 I D 1.8858
1230 Q D 0.1495
1231 L D 0.4916
1232 W D 0.0000
1233 C D 0.0000
1234 H D -0.0341
1235 L D 1.0543
1236 D D 0.2785
1237 V D 0.0000
1238 G D 0.0000
1239 G D -0.9583
1240 G D -0.8173
1241 T D 0.0000
1242 K D -1.2602
1243 L D 0.0000
1244 T D -0.6044
1245 V D -0.2471
1246 L D 0.0000
1247 G D 0.0000
1248 Q D -1.7791
1249 P D -1.3617
1250 K D -1.4594
1251 A D -0.9196
1252 A D -0.5204
1253 P D -0.4761
1254 S D -0.4953
1255 V D 0.0000
1256 T D -0.4262
1257 L D 0.0000
1258 F D 0.0000
1259 P D -0.3476
1260 P D 0.0000
1261 S D -0.5207
1262 S D -1.0608
1263 E D -1.5431
1264 E D 0.0000
1265 L D -1.9202
1266 Q D -2.0598
1267 A D -1.6998
1268 N D -2.7235
1269 K D -2.4987
1270 A D 0.0000
1271 T D -0.3153
1272 L D 0.0000
1273 V D 0.0000
1274 C D 0.0000
1275 L D 0.0000
1276 I D 0.0000
1277 S D -0.3135
1278 D D -0.6295
1279 F D 0.0000
1280 Y D 0.0000
1281 P D -0.8192
1282 G D -0.4294
1283 A D -0.1820
1284 V D -0.0571
1285 T D -0.2274
1286 V D -0.2326
1287 A D -0.0683
1288 W D 0.0000
1289 K D -0.6472
1290 A D 0.0000
1291 D D -1.4673
1292 S D -0.8117
1293 S D -0.2618
1294 P D 0.2066
1295 V D 1.0606
1296 K D -0.0491
1297 A D 0.0209
1298 G D -0.5536
1299 V D -0.0222
1300 E D -1.4380
1301 T D 0.0000
1302 T D -0.5398
1303 T D 0.0000
1304 P D -0.6023
1305 S D -0.7866
1306 K D -1.2918
1307 Q D -1.8692
1308 S D -1.4422
1309 N D -1.5213
1310 N D -1.1642
1311 K D 0.0000
1312 Y D -0.2878
1313 A D 0.0000
1314 A D 0.0000
1315 S D 0.0000
1316 S D 0.0000
1317 Y D 0.0000
1318 L D 0.0000
1319 S D -0.3296
1320 L D -1.1312
1321 T D -2.1697
1322 P D 0.0000
1323 E D -3.3573
1324 Q D -3.0401
1325 W D -2.6767
1326 K D -3.2343
1327 S D -2.6753
1328 H D -2.6380
1329 R D -2.7417
1330 S D -1.4971
1331 Y D 0.0000
1332 S D -0.9548
1333 C D 0.0000
1334 Q D -0.8974
1335 V D 0.0000
1336 T D -0.5783
1337 H D -1.0416
1338 E D -2.2826
1339 G D -1.2233
1340 S D -0.4648
1341 T D -0.5991
1342 V D -0.3939
1343 E D -1.4869
1344 K D -1.2835
1345 T D -0.7436
1346 V D -0.2588
1347 A D -0.8085
1348 P D -1.3616
1349 T D -1.4056
1350 E D -1.8965
1351 C D -1.0521
1352 S D -0.8174

 

Laboratory of Theory of Biopolymers 2015