Project name: 1abo_modified_chains-AC.pdb_stat_DIBS

Chain sequence(s)	A: NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS; C: APTMPPPLPP
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.0971
• Maximal score value: 1.2413
• Average score: -0.75
• Total score value: -50.9984

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
64	N	A	-1.3119
65	L	A	-0.8167
66	F	A	-0.6068
67	V	A	-0.5924
68	A	A	0.0000
69	L	A	-0.5663
70	Y	A	-1.2057
71	D	A	-1.8313
72	F	A	0.0000
73	V	A	1.2413
74	A	A	0.2414
75	S	A	-0.5357
76	G	A	-1.4568
77	D	A	-2.3297
78	N	A	-2.3609
79	T	A	-1.1576
80	L	A	-0.6946
81	S	A	-0.0160
82	I	A	0.0000
83	T	A	-1.4883
84	K	A	-2.3702
85	G	A	-1.5508
86	E	A	0.0000
87	K	A	-2.2859
88	L	A	0.0000
89	R	A	-2.5032
90	V	A	0.0000
91	L	A	0.1587
92	G	A	0.3523
93	Y	A	0.2006
94	N	A	-1.0578
95	H	A	-1.7700
96	N	A	-2.1386
97	G	A	-1.6909
98	E	A	-2.1943
99	W	A	0.0000
100	C	A	0.0000
101	E	A	-0.6702
102	A	A	0.0000
103	Q	A	-2.3043
104	T	A	0.0000
105	K	A	-3.0971
106	N	A	-2.4845
107	G	A	-1.9753
108	Q	A	-2.2869
109	G	A	0.0000
110	W	A	-0.7809
111	V	A	0.0000
112	P	A	0.0000
113	S	A	-1.0648
114	N	A	-1.2228
115	Y	A	0.0000
116	I	A	0.0000
117	T	A	-0.1322
118	P	A	-0.5476
119	V	A	-0.2085
120	N	A	-1.1356
121	S	A	-0.7293
1	A	C	-0.6757
2	P	C	0.0000
3	T	C	-0.2371
4	M	C	-0.1105
5	P	C	-0.1859
6	P	C	-0.2737
7	P	C	0.2279
8	L	C	1.1205
9	P	C	0.1790
10	P	C	-0.0648