Project name: c1c249fe9bd2ec1

Status: done

submitted: 2017-12-06 11:46:50, status changed: 2017-12-06 13:09:07
Settings
Chain sequence(s) A: QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCGTVGGPLLLEVIRRWWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
B: QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCGTVGGPLLLEVIRRWWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0239
Maximal score value
2.2026
Average score
-0.7609
Total score value
-999.7788

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.0608
2 A A -0.2159
3 Y A 0.3410
4 L A 0.0000
5 Q A -0.9531
6 Q A -0.8994
7 S A -1.1272
8 G A -1.0285
9 A A -0.8426
10 E A -1.5672
11 L A -0.5024
12 V A -0.9522
13 R A -1.9640
14 P A -1.6471
15 G A -1.2382
16 A A -0.8865
17 S A -1.1961
18 V A 0.0000
19 K A -2.1382
20 M A 0.0000
21 S A -0.8729
22 C A 0.0000
23 K A -1.1015
24 A A 0.0000
25 S A -0.1094
26 G A -0.1688
27 Y A 0.5957
28 T A 0.3480
29 F A 0.0615
30 T A -0.3800
31 S A 0.2336
32 Y A 0.4149
33 N A -0.3259
34 M A 0.0000
35 H A -0.0879
36 W A 0.0000
37 V A 0.0000
38 K A 0.0000
39 Q A -0.9899
40 T A -1.4535
41 P A -1.6187
42 R A -2.4777
43 Q A -2.3012
44 G A -1.4618
45 L A 0.0000
46 E A -0.8638
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 A A -0.5526
51 I A 0.0000
52 Y A -0.8257
53 P A 0.0000
54 G A -1.3659
55 N A -2.0120
56 G A -1.9927
57 D A -2.3019
58 T A -1.1152
59 S A -0.7862
60 Y A -1.6016
61 N A -2.3305
62 Q A -3.0268
63 K A -3.2004
64 F A 0.0000
65 K A -3.3212
66 G A -2.6576
67 K A -3.0350
68 A A 0.0000
69 T A -1.0686
70 L A 0.0000
71 T A -0.6431
72 V A -0.9459
73 D A -1.5350
74 K A -1.8850
75 S A -1.1372
76 S A -0.9878
77 S A -0.9681
78 T A 0.0000
79 A A 0.0000
80 Y A -0.5469
81 M A 0.0000
82 Q A -1.5449
83 L A 0.0000
84 S A -1.3127
85 S A -1.1059
86 L A 0.0000
87 T A -1.3896
88 S A -1.6160
89 E A -2.1258
90 D A -1.3075
91 S A 0.0000
92 A A 0.0000
93 V A 0.1997
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 G A 0.0000
98 T A 0.0000
99 V A 0.0000
100 G A 0.0000
101 G A 0.0000
102 P A 0.0000
103 L A 0.0000
104 L A 0.0000
105 L A 0.0000
106 E A 0.0000
107 V A 0.0000
108 I A 0.4295
109 R A 0.0000
110 R A -0.8989
111 W A -0.2529
112 W A 0.0000
113 G A 0.0000
114 T A -0.3093
115 G A -0.3149
116 T A 0.0000
117 T A -0.2726
118 V A 0.0000
119 T A 0.0000
120 V A 0.0000
121 S A -0.7618
122 G A -1.2229
123 P A -0.8897
124 S A -0.3406
125 V A -0.5601
126 F A -0.4571
127 P A -1.0992
128 L A 0.0000
129 A A 0.0000
130 P A 0.0000
131 S A -1.2289
132 S A -1.2295
133 K A -1.8384
134 S A -1.2458
135 T A -1.0380
136 S A -0.8677
137 G A -0.8428
138 G A -0.8638
139 T A -0.7165
140 A A 0.0000
141 A A 0.0000
142 L A 0.0000
143 G A 0.0000
144 C A 0.0000
145 L A 0.0000
146 V A 0.0000
147 K A 0.0000
148 D A -0.7125
149 Y A 0.0000
150 F A 0.0000
151 P A 0.0000
152 E A -1.9066
153 P A -1.4685
154 V A -1.1096
155 T A -0.7065
156 V A -0.2204
157 S A -0.3967
158 W A 0.0000
159 N A -0.7218
160 S A -0.7218
161 G A -0.6105
162 A A -0.2740
163 L A 0.0080
164 T A -0.1867
165 S A -0.1814
166 G A -0.2324
167 V A 0.1648
168 H A -0.1158
169 T A 0.0670
170 F A 0.0000
171 P A -0.5780
172 A A -0.2495
173 V A -0.1199
174 L A 0.3133
175 Q A -0.0697
176 S A -0.2315
177 S A -0.4055
178 G A -0.5085
179 L A -0.1933
180 Y A 0.0000
181 S A -0.1992
182 L A 0.0000
183 S A 0.0000
184 S A 0.0000
185 V A 0.0000
186 V A 0.0000
187 T A -0.1593
188 V A 0.0000
189 P A -0.4854
190 S A -0.6031
191 S A -0.4928
192 S A -0.5627
193 L A -0.7214
194 G A -0.9448
195 T A -0.6988
196 Q A -1.1627
197 T A -1.0176
198 Y A 0.0000
199 I A -1.3132
200 C A 0.0000
201 N A -1.6266
202 V A 0.0000
203 N A -2.0444
204 H A 0.0000
205 K A -2.8960
206 P A -1.9903
207 S A -1.5537
208 N A -2.5239
209 T A -2.0192
210 K A -2.6865
211 V A -1.6460
212 D A -2.7205
213 K A -2.2792
214 K A -2.3796
215 A A 0.0000
216 E A -2.8461
217 P A -1.9509
218 K A -2.6876
219 S A -1.9183
220 C A -1.2636
221 D A -2.9027
222 K A -3.2441
223 T A -2.1043
224 H A -2.3637
225 T A -1.4078
226 C A 0.0024
227 P A -0.2536
228 P A 0.0575
229 C A 0.4802
230 P A -0.1712
231 A A -1.0063
232 P A -1.0720
233 E A -1.2961
234 L A 1.2687
235 L A 1.5154
236 G A 0.2399
237 G A -0.1572
238 P A 0.0000
239 S A 0.1427
240 V A 0.0000
241 F A 1.3515
242 L A 1.1604
243 F A 1.4030
244 P A 0.0126
245 P A 0.0000
246 K A -2.2292
247 P A -1.3762
248 K A -1.1597
249 D A 0.0000
250 T A 0.0000
251 L A -0.2924
252 M A 0.3514
253 I A 1.3050
254 S A -0.1428
255 R A -1.6826
256 T A -0.9428
257 P A 0.0000
258 E A -1.3504
259 V A 0.0000
260 T A 0.5314
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.6974
265 D A -1.0299
266 V A 0.0000
267 S A -1.6757
268 H A -2.0021
269 E A -2.8620
270 D A -2.3570
271 P A -2.3887
272 E A -2.8700
273 V A -1.8271
274 K A -1.9795
275 F A -1.1630
276 N A -1.2014
277 W A 0.0000
278 Y A -1.1224
279 V A -1.0275
280 D A -2.2604
281 G A -1.0084
282 V A 0.3596
283 E A -1.3642
284 V A -0.7342
285 H A -1.9732
286 N A -2.1730
287 A A -1.6208
288 K A -2.4748
289 T A -1.9484
290 K A -2.6602
291 P A -2.3171
292 R A -3.3941
293 E A -4.0239
294 E A -3.5099
295 Q A -2.2451
296 Y A -0.1040
297 N A -1.2168
298 S A -1.1461
299 T A -1.7302
300 Y A -2.6857
301 R A -3.0598
302 V A 0.0000
303 V A 0.0000
304 S A 0.0000
305 V A -0.8448
306 L A 0.0000
307 T A -0.8086
308 V A 0.0000
309 L A -0.1400
310 H A -0.6587
311 Q A -1.6082
312 D A -1.7170
313 W A 0.0000
314 L A -1.1189
315 N A -2.1180
316 G A -2.0084
317 K A -2.2697
318 E A -2.2518
319 Y A 0.0000
320 K A -1.5595
321 C A 0.0000
322 K A -1.3800
323 V A 0.0000
324 S A -1.3080
325 N A 0.0000
326 K A -2.2911
327 A A -1.5648
328 L A -0.5272
329 P A -0.5897
330 A A -0.4748
331 P A -0.7176
332 I A -0.4340
333 E A -1.4232
334 K A -0.9756
335 T A -0.8575
336 I A -0.1333
337 S A -0.9998
338 K A 0.0000
339 A A -0.9534
340 K A -2.1794
341 G A -1.8468
342 Q A -1.9923
343 P A -2.0584
344 R A -2.5272
345 E A -2.7478
346 P A 0.0000
347 Q A -1.4043
348 V A 0.0000
349 Y A 0.0000
350 T A 0.0000
351 L A 0.0000
352 P A -0.4436
353 P A -0.8814
354 S A -1.4644
355 R A -2.6313
356 D A -2.5356
357 E A 0.0000
358 L A -1.6042
359 T A -1.3505
360 K A -1.8914
361 N A -2.3003
362 Q A -2.2439
363 V A 0.0000
364 S A 0.0000
365 L A 0.0000
366 T A 0.0000
367 C A 0.0000
368 L A 0.0000
369 V A 0.0000
370 K A -0.6454
371 G A -1.2053
372 F A 0.0000
373 Y A -1.1303
374 P A 0.0000
375 S A -0.3454
376 D A -1.0740
377 I A 0.0000
378 A A -0.6072
379 V A 0.0000
380 E A -1.0704
381 W A 0.0000
382 E A -1.5968
383 S A 0.0000
384 N A -1.8223
385 G A -1.8922
386 Q A -2.3405
387 P A -2.0193
388 E A -1.9465
389 N A -2.2681
390 N A -1.9010
391 Y A -1.1783
392 K A -1.1119
393 T A -0.4128
394 T A 0.0000
395 P A -0.1793
396 P A 0.0442
397 V A 0.3539
398 L A 0.4861
399 D A -0.6469
400 S A -1.1933
401 D A -1.9022
402 G A -0.9728
403 S A 0.0000
404 F A 0.0171
405 F A 0.0000
406 L A 0.0000
407 Y A 0.0000
408 S A 0.0000
409 K A 0.0000
410 L A 0.0000
411 T A -1.0693
412 V A 0.0000
413 D A -2.4878
414 K A -2.4026
415 S A -2.1221
416 R A -1.8616
417 W A 0.0000
418 Q A -2.3396
419 Q A -2.2162
420 G A -1.4122
421 N A -0.6869
422 V A 0.7983
423 F A 0.0000
424 S A 0.0000
425 C A 0.0000
426 S A 0.0000
427 V A 0.0000
428 M A 0.0000
429 H A 0.0000
430 E A -1.2428
431 A A -1.7442
432 L A -1.5679
433 H A -1.8188
434 N A -1.7053
435 H A -1.2121
436 Y A -0.4148
437 T A -0.7427
438 Q A -1.1037
439 K A -0.9636
440 S A -0.3106
441 L A 0.0000
442 S A 0.0872
443 L A -0.5006
444 S A -0.7418
445 P A -0.9925
446 G A -1.5278
447 K A -2.4711
448 Q B -0.9949
449 A B -0.2351
450 Y B 0.2799
451 L B -0.3592
452 Q B -1.2393
453 Q B -0.9383
454 S B -1.1334
455 G B -0.9352
456 A B -0.5140
457 E B -0.9309
458 L B 0.1092
459 V B -0.5336
460 R B -1.6174
461 P B -1.5518
462 G B -1.1704
463 A B -0.8626
464 S B -1.0979
465 V B 0.0000
466 K B -2.0924
467 M B 0.0000
468 S B -0.8437
469 C B 0.0000
470 K B -1.0207
471 A B 0.0000
472 S B -0.3111
473 G B -0.4584
474 Y B -0.0242
475 T B -0.2059
476 F B 0.0000
477 T B -0.7244
478 S B -0.3625
479 Y B 0.0457
480 N B 0.0000
481 M B 0.0000
482 H B 0.0000
483 W B 0.0000
484 V B 0.0000
485 K B 0.0000
486 Q B -0.8973
487 T B -1.4695
488 P B -1.7435
489 R B -2.5844
490 Q B -2.3631
491 G B -1.2841
492 L B -0.7524
493 E B -1.1137
494 W B 0.0000
495 I B 0.0000
496 G B 0.0000
497 A B 0.0000
498 I B 0.0000
499 Y B -0.7428
500 P B 0.0000
501 G B -1.1749
502 N B -1.9653
503 G B -1.7080
504 D B -1.3625
505 T B -0.4727
506 S B -0.3016
507 Y B -1.3732
508 N B -2.3274
509 Q B -2.9502
510 K B -3.1969
511 F B 0.0000
512 K B -3.1582
513 G B -2.2735
514 K B -2.0069
515 A B 0.0000
516 T B -0.9049
517 L B 0.0000
518 T B -0.4375
519 V B -0.7419
520 D B -1.8935
521 K B -2.2301
522 S B -1.3560
523 S B -1.2000
524 S B -1.1665
525 T B 0.0000
526 A B 0.0000
527 Y B -0.4672
528 M B 0.0000
529 Q B -1.4872
530 L B 0.0000
531 S B -1.0442
532 S B -0.8014
533 L B 0.0000
534 T B -1.2377
535 S B -1.4972
536 E B -1.9993
537 D B 0.0000
538 S B -0.7039
539 A B 0.0000
540 V B 0.3005
541 Y B 0.0000
542 F B 0.0000
543 C B 0.0000
544 G B 0.0000
545 T B 0.1793
546 V B 0.0000
547 G B 0.0000
548 G B 0.0000
549 P B 0.0000
550 L B 0.0000
551 L B 1.7600
552 L B 1.8471
553 E B 0.4471
554 V B 2.1312
555 I B 2.2026
556 R B 0.3434
557 R B -1.1432
558 W B -0.2651
559 W B 0.0469
560 G B 0.0000
561 T B -0.1474
562 G B -0.3421
563 T B -0.4185
564 T B -0.3490
565 V B 0.0000
566 T B -0.1471
567 V B 0.0000
568 S B -0.5839
569 G B 0.0000
570 P B -0.5172
571 S B -0.3637
572 V B 0.8127
573 F B 1.9370
574 P B 0.9581
575 L B 0.8351
576 A B -0.4939
577 P B 0.0000
578 S B -0.2549
579 S B -1.0705
580 K B -1.2854
581 S B 0.0000
582 T B 0.0000
583 S B -1.3767
584 G B -1.0519
585 G B -0.7544
586 T B -0.3796
587 A B -0.2669
588 A B 0.0000
589 L B 0.0000
590 G B 0.0000
591 C B 0.0000
592 L B 0.0000
593 V B 0.0000
594 K B 0.0000
595 D B -0.2515
596 Y B 0.0000
597 F B 0.0000
598 P B 0.0000
599 E B -0.9595
600 P B -0.9677
601 V B -0.8171
602 T B -0.7338
603 V B -0.4107
604 S B -0.4553
605 W B 0.0000
606 N B -0.6749
607 S B -0.6765
608 G B -0.5887
609 A B -0.2593
610 L B -0.0025
611 T B -0.1890
612 S B -0.2044
613 G B -0.3223
614 V B 0.1173
615 H B -0.2787
616 T B -0.0016
617 F B 0.0000
618 P B -0.4042
619 A B 0.1172
620 V B 0.5186
621 L B 1.3609
622 Q B 0.2548
623 S B 0.0342
624 S B -0.1174
625 G B 0.4423
626 L B 0.6054
627 Y B 0.5032
628 S B 0.0919
629 L B 0.0000
630 S B 0.0000
631 S B 0.0000
632 V B 0.0000
633 V B 0.0000
634 T B -0.2019
635 V B 0.0000
636 P B -0.4129
637 S B -0.6295
638 S B -0.7587
639 S B -0.7798
640 L B -1.3381
641 G B -1.6590
642 T B -0.8881
643 Q B -1.2735
644 T B -1.0898
645 Y B 0.0000
646 I B -1.2647
647 C B 0.0000
648 N B -1.5228
649 V B 0.0000
650 N B -2.0509
651 H B 0.0000
652 K B -2.8180
653 P B -1.5222
654 S B -1.3061
655 N B -2.4832
656 T B -1.7552
657 K B -2.5527
658 V B -1.2718
659 D B -2.6010
660 K B -2.3107
661 K B -2.4317
662 A B 0.0000
663 E B -2.8140
664 P B -2.3148
665 K B -2.4073
666 S B -1.3782
667 C B -0.4658
668 D B -1.7120
669 K B -2.6729
670 T B -1.8407
671 H B -1.4610
672 T B -0.5115
673 C B 0.4213
674 P B 0.1539
675 P B 0.1793
676 C B 0.3239
677 P B -0.4142
678 A B -0.5556
679 P B -0.6956
680 E B -0.8360
681 L B 1.3074
682 L B 1.2523
683 G B 0.1615
684 G B -0.2435
685 P B 0.0000
686 S B -0.1794
687 V B 0.0000
688 F B 1.2228
689 L B 0.8427
690 F B 1.0014
691 P B -0.2907
692 P B 0.0000
693 K B -2.1341
694 P B -1.2463
695 K B -0.9875
696 D B 0.0000
697 T B 0.0000
698 L B -0.1829
699 M B 0.6681
700 I B 1.5438
701 S B 0.1469
702 R B -1.2597
703 T B -0.6281
704 P B 0.0000
705 E B -0.8940
706 V B 0.0000
707 T B 0.4439
708 C B 0.0000
709 V B 0.0000
710 V B 0.0000
711 V B -0.7841
712 D B -2.2926
713 V B 0.0000
714 S B -1.1864
715 H B -1.3974
716 E B -1.0763
717 D B 0.0000
718 P B -1.8366
719 E B -2.4583
720 V B -1.6640
721 K B -2.0883
722 F B -1.1913
723 N B -1.1452
724 W B 0.0000
725 Y B -0.5941
726 V B -0.8663
727 D B -2.1682
728 G B -0.8318
729 V B 0.7700
730 E B -0.5282
731 V B -0.4770
732 H B -1.8605
733 N B -2.1327
734 A B -1.6763
735 K B -2.4364
736 T B -1.9501
737 K B -2.6933
738 P B -2.5678
739 R B -3.5693
740 E B -3.6381
741 E B -3.5814
742 Q B -2.3279
743 Y B -0.3109
744 N B -1.4486
745 S B -1.3642
746 T B -2.0970
747 Y B -2.6728
748 R B -2.6497
749 V B 0.0000
750 V B 0.0000
751 S B 0.0000
752 V B -0.7426
753 L B 0.0000
754 T B -0.5169
755 V B 0.0000
756 L B 0.6607
757 H B -0.1050
758 Q B -1.2836
759 D B -1.0999
760 W B 0.0000
761 L B -0.9750
762 N B -2.1278
763 G B -2.2442
764 K B -2.3383
765 E B -2.3376
766 Y B 0.0000
767 K B -1.6530
768 C B 0.0000
769 K B -1.6756
770 V B 0.0000
771 S B -1.3191
772 N B 0.0000
773 K B -1.8462
774 A B 0.0000
775 L B 0.0000
776 P B -0.4070
777 A B -0.5903
778 P B -0.8757
779 I B -0.7944
780 E B -2.0771
781 K B -1.1816
782 T B -0.9954
783 I B -0.2133
784 S B -1.2595
785 K B -1.3446
786 A B -1.2367
787 K B -2.4333
788 G B -2.0693
789 Q B -2.2825
790 P B -2.1158
791 R B -2.4932
792 E B -2.8172
793 P B 0.0000
794 Q B -1.4004
795 V B -0.9471
796 Y B 0.0000
797 T B 0.0000
798 L B 0.0000
799 P B -0.3688
800 P B -0.9019
801 S B 0.0000
802 R B -2.6936
803 D B -2.9640
804 E B 0.0000
805 L B -2.2165
806 T B -2.0918
807 K B -3.0619
808 N B -2.9617
809 Q B -2.8668
810 V B 0.0000
811 S B 0.0000
812 L B 0.0000
813 T B 0.0000
814 C B 0.0000
815 L B 0.0000
816 V B 0.0000
817 K B -0.6892
818 G B -1.1865
819 F B 0.0000
820 Y B -1.2720
821 P B 0.0000
822 S B -0.2086
823 D B -0.9473
824 I B -0.5560
825 A B -0.3873
826 V B 0.0000
827 E B -0.8994
828 W B 0.0000
829 E B -1.7000
830 S B 0.0000
831 N B -1.8858
832 G B -1.8994
833 Q B -2.3595
834 P B -1.9801
835 E B -1.9951
836 N B -2.0826
837 N B -1.4351
838 Y B -0.8802
839 K B -0.8194
840 T B -0.3076
841 T B 0.0000
842 P B -0.2202
843 P B -0.0108
844 V B 0.0000
845 L B 0.4305
846 D B -0.6990
847 S B -1.2756
848 D B -1.8953
849 G B -0.9192
850 S B 0.0000
851 F B -0.0357
852 F B 0.0000
853 L B 0.0000
854 Y B 0.0000
855 S B 0.0000
856 K B 0.0000
857 L B 0.0000
858 T B -0.9083
859 V B 0.0000
860 D B -2.6775
861 K B -2.9325
862 S B -2.6649
863 R B -2.9389
864 W B 0.0000
865 Q B -2.5556
866 Q B -2.4281
867 G B -1.2594
868 N B -0.9336
869 V B 0.4204
870 F B 0.0000
871 S B -0.8168
872 C B 0.0000
873 S B 0.0000
874 V B 0.0000
875 M B 0.0000
876 H B 0.0000
877 E B -1.4497
878 A B -1.8737
879 L B 0.0000
880 H B -1.9752
881 N B -1.8329
882 H B -1.4114
883 Y B -0.4066
884 T B -0.8107
885 Q B -1.2807
886 K B -1.3649
887 S B -0.5556
888 L B 0.0000
889 S B -0.0755
890 L B -0.0922
891 S B -0.5931
892 P B -1.0286
893 G B -1.3936
894 K B -2.0575
895 Q C -0.7063
896 I C 0.3907
897 V C 1.1521
898 L C 0.0000
899 S C -0.5124
900 Q C -0.5494
901 S C -0.5367
902 P C -0.0760
903 A C 0.1116
904 I C 0.3969
905 L C 0.1615
906 S C -0.6314
907 A C 0.0000
908 S C -1.8978
909 P C -2.1875
910 G C -2.4693
911 E C -3.2716
912 K C -3.3917
913 V C 0.0000
914 T C -0.6235
915 M C 0.0000
916 T C -0.6768
917 C C 0.0000
918 R C -1.9094
919 A C -0.5406
920 S C -0.2560
921 S C -0.3847
922 S C -0.4428
923 V C 0.2759
924 S C 0.3411
925 Y C 1.2570
926 M C 0.0000
927 H C 0.0000
928 W C 0.0000
929 Y C 0.0000
930 Q C 0.0000
931 Q C -1.3610
932 K C -2.3425
933 P C -1.6205
934 G C -1.1558
935 S C -1.1516
936 S C -0.7904
937 P C 0.0000
938 K C -1.0087
939 P C 0.0000
940 W C 0.0000
941 I C 0.0000
942 Y C 0.1384
943 A C 0.2057
944 P C -0.1443
945 S C -0.6972
946 N C -0.7468
947 L C 0.1425
948 A C 0.0000
949 S C -0.4882
950 G C -0.4135
951 V C -0.1294
952 P C -0.1054
953 A C -0.0469
954 R C -1.0619
955 F C 0.0000
956 S C -0.3132
957 G C 0.0000
958 S C -0.7378
959 G C -0.9460
960 S C -0.6607
961 G C -0.5561
962 T C -0.9717
963 S C -1.1520
964 Y C 0.0000
965 S C -0.6407
966 L C 0.0000
967 T C -0.8225
968 I C 0.0000
969 S C -2.2444
970 R C -3.5666
971 V C 0.0000
972 E C -2.6998
973 A C -1.6022
974 E C -2.3449
975 D C 0.0000
976 A C -1.0330
977 A C 0.0000
978 T C -0.6165
979 Y C 0.0000
980 Y C -0.0422
981 C C 0.0000
982 Q C 0.0000
983 Q C 0.0000
984 W C 0.5773
985 S C 0.7709
986 F C 1.3081
987 N C -0.4813
988 P C -0.2723
989 P C -0.2071
990 T C -0.0121
991 F C 0.0000
992 G C 0.0000
993 A C -0.4008
994 G C -0.1937
995 T C 0.0000
996 K C -0.2315
997 L C 0.0000
998 E C 0.0000
999 L C -0.8099
1000 K C -1.6126
1001 R C -1.5318
1002 T C -0.2256
1003 V C 0.7975
1004 A C 0.3183
1005 A C -0.0094
1006 P C 0.0000
1007 S C -0.2595
1008 V C 0.0000
1009 F C 0.0000
1010 I C 0.0300
1011 F C 0.0000
1012 P C -0.6649
1013 P C 0.0000
1014 S C 0.0000
1015 D C -2.8260
1016 E C -2.5939
1017 Q C 0.0000
1018 L C -2.0238
1019 K C -2.6323
1020 S C -1.4393
1021 G C -1.2763
1022 T C -0.8094
1023 A C 0.0000
1024 S C 0.0000
1025 V C 0.0000
1026 V C 0.0000
1027 C C 0.0000
1028 L C 0.0000
1029 L C 0.0000
1030 N C -0.3827
1031 N C -0.8109
1032 F C 0.0000
1033 Y C 0.0000
1034 P C -1.3544
1035 R C -1.9809
1036 E C -2.8164
1037 A C -2.1101
1038 K C -2.2558
1039 V C -1.2035
1040 Q C -0.5341
1041 W C 0.0000
1042 K C -0.7968
1043 V C 0.0000
1044 D C -2.6115
1045 N C -1.8253
1046 A C -0.4802
1047 L C 0.5420
1048 Q C -0.2413
1049 S C -0.4319
1050 G C -0.8154
1051 N C -0.6692
1052 S C -0.9491
1053 Q C -1.2356
1054 E C -1.7969
1055 S C -0.6995
1056 V C -0.4905
1057 T C -0.9863
1058 E C -2.0149
1059 Q C -1.9229
1060 D C -2.1036
1061 S C -1.8482
1062 K C -2.3840
1063 D C -2.1043
1064 S C -1.9769
1065 T C 0.0000
1066 Y C 0.0000
1067 S C 0.0000
1068 L C 0.0000
1069 S C 0.0000
1070 S C 0.0000
1071 T C -0.5588
1072 L C 0.0000
1073 T C -0.3149
1074 L C -0.5344
1075 S C -1.2076
1076 K C -2.2891
1077 A C -1.8584
1078 D C -2.0757
1079 Y C 0.0000
1080 E C -3.8637
1081 K C -3.7973
1082 H C -3.6352
1083 K C -3.9723
1084 V C -2.3831
1085 Y C 0.0000
1086 A C 0.0000
1087 C C 0.0000
1088 E C -0.7521
1089 V C 0.0000
1090 T C -1.1754
1091 H C 0.0000
1092 Q C -1.5972
1093 G C -0.3854
1094 L C -0.2757
1095 S C -0.4949
1096 S C -0.4712
1097 P C -0.6441
1098 V C -0.0891
1099 T C -0.4905
1100 K C -0.8321
1101 S C -0.7373
1102 F C -1.2885
1103 N C -2.7674
1104 R C -3.6523
1105 Q D -0.8055
1106 I D 0.0000
1107 V D 1.0730
1108 L D 0.0000
1109 S D -0.5149
1110 Q D 0.0000
1111 S D -0.4159
1112 P D 0.0918
1113 A D 0.4240
1114 I D 1.0902
1115 L D 0.5048
1116 S D -0.1513
1117 A D 0.0000
1118 S D -1.5091
1119 P D -2.1522
1120 G D -2.3001
1121 E D -2.7818
1122 K D -3.2754
1123 V D 0.0000
1124 T D -0.6091
1125 M D 0.0000
1126 T D -0.7064
1127 C D 0.0000
1128 R D -1.8532
1129 A D 0.0000
1130 S D -0.4048
1131 S D -0.4844
1132 S D -0.5428
1133 V D 0.0000
1134 S D 0.2568
1135 Y D 1.1586
1136 M D 0.0000
1137 H D 0.0000
1138 W D 0.0000
1139 Y D 0.0000
1140 Q D 0.0000
1141 Q D -1.4223
1142 K D -2.2912
1143 P D -1.5018
1144 G D -1.0462
1145 S D -1.0967
1146 S D -0.8755
1147 P D -1.0930
1148 K D -1.3276
1149 P D -0.5270
1150 W D 0.0000
1151 I D 0.0000
1152 Y D 0.1938
1153 A D 0.1815
1154 P D -0.2168
1155 S D -0.7889
1156 N D -0.9923
1157 L D -0.3967
1158 A D -0.3312
1159 S D -0.4079
1160 G D -0.4034
1161 V D -0.5315
1162 P D -0.6678
1163 A D -0.8640
1164 R D -2.6820
1165 F D 0.0000
1166 S D -0.8406
1167 G D 0.0000
1168 S D -0.6859
1169 G D -0.7917
1170 S D -0.4333
1171 G D -0.5942
1172 T D -0.9747
1173 S D -1.1037
1174 Y D 0.0000
1175 S D -0.5851
1176 L D 0.0000
1177 T D -1.0617
1178 I D 0.0000
1179 S D -2.7245
1180 R D -3.7726
1181 V D 0.0000
1182 E D -3.1946
1183 A D -1.8425
1184 E D -2.4729
1185 D D 0.0000
1186 A D -1.1667
1187 A D 0.0000
1188 T D -0.5528
1189 Y D 0.0000
1190 Y D 0.0000
1191 C D 0.0000
1192 Q D 0.0000
1193 Q D 0.0000
1194 W D 0.0000
1195 S D 0.6229
1196 F D 1.2643
1197 N D -0.2177
1198 P D -0.3408
1199 P D -0.2955
1200 T D 0.0247
1201 F D 0.3194
1202 G D 0.0000
1203 A D -0.2972
1204 G D -0.0687
1205 T D 0.0000
1206 K D -0.1987
1207 L D 0.0000
1208 E D 0.0000
1209 L D -0.8798
1210 K D -0.8749
1211 R D 0.0000
1212 T D -0.1916
1213 V D 0.1477
1214 A D 0.0000
1215 A D 0.0026
1216 P D 0.0000
1217 S D -0.3428
1218 V D 0.0000
1219 F D -0.0230
1220 I D 0.0164
1221 F D 0.0000
1222 P D -0.6873
1223 P D 0.0000
1224 S D -1.6355
1225 D D -2.9883
1226 E D -2.9438
1227 Q D 0.0000
1228 L D -2.3089
1229 K D -2.8378
1230 S D -1.8621
1231 G D -1.4570
1232 T D -1.0303
1233 A D 0.0000
1234 S D 0.0000
1235 V D 0.0000
1236 V D 0.0000
1237 C D 0.0000
1238 L D 0.0000
1239 L D 0.0000
1240 N D -0.5275
1241 N D -1.2381
1242 F D 0.0000
1243 Y D 0.0000
1244 P D -1.6230
1245 R D -2.6831
1246 E D -3.0410
1247 A D -2.3020
1248 K D -2.2546
1249 V D -1.0534
1250 Q D -0.6183
1251 W D 0.0000
1252 K D -0.6916
1253 V D 0.0000
1254 D D -2.0370
1255 N D -1.5469
1256 A D -0.2499
1257 L D 0.8618
1258 Q D -0.1138
1259 S D -0.4921
1260 G D -0.9405
1261 N D -0.8413
1262 S D -1.2624
1263 Q D -1.7452
1264 E D -1.6390
1265 S D -0.8448
1266 V D -0.8035
1267 T D -1.2543
1268 E D -2.3650
1269 Q D -2.1742
1270 D D -2.4203
1271 S D -2.0816
1272 K D -2.4311
1273 D D -1.8475
1274 S D -1.8097
1275 T D 0.0000
1276 Y D 0.0000
1277 S D 0.0000
1278 L D 0.0000
1279 S D 0.0000
1280 S D 0.0000
1281 T D -0.7162
1282 L D 0.0000
1283 T D -0.4638
1284 L D -0.5108
1285 S D -1.1593
1286 K D -2.3553
1287 A D -1.7834
1288 D D -2.3740
1289 Y D 0.0000
1290 E D -3.6098
1291 K D -3.5118
1292 H D -3.1363
1293 K D -3.2902
1294 V D -2.4161
1295 Y D 0.0000
1296 A D -0.9047
1297 C D 0.0000
1298 E D -0.9442
1299 V D 0.0000
1300 T D -1.1917
1301 H D 0.0000
1302 Q D -1.7932
1303 G D -0.5648
1304 L D -0.0490
1305 S D -0.4114
1306 S D -0.5630
1307 P D -0.4644
1308 V D -0.0520
1309 T D -0.5870
1310 K D -0.9292
1311 S D -0.9362
1312 F D -1.1465
1313 N D -2.2202
1314 R D -2.5867

 

Laboratory of Theory of Biopolymers 2015