Project name: 3jti_FULL_Valen

Status: done

submitted: 2018-10-09 15:19:29, status changed: 2018-10-09 15:23:12
Settings
Chain sequence(s) A: NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN
B: KGAIIGLM
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4066
Maximal score value
1.9202
Average score
-0.7135
Total score value
-90.6158

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A 0.3136
2 L A 0.0000
3 Y A 0.7452
4 Q A 0.0000
5 F A 0.0000
6 K A -0.4581
7 N A -0.4374
8 M A 0.0000
9 I A 0.0000
10 Q A -0.7840
11 C A -0.4491
12 T A -0.0304
13 V A -0.1402
14 P A -0.6065
15 S A -0.6515
17 R A -0.9792
18 S A -0.6499
19 W A -0.3245
20 A A -0.1926
21 D A -0.7407
22 F A 0.0000
23 A A -0.2737
24 D A -0.9279
25 Y A 0.0000
26 G A 0.0000
27 C A 0.0000
28 Y A 0.0000
29 C A 0.0000
30 G A 0.0000
31 K A -1.3274
32 G A 0.0000
33 G A -1.0131
34 S A -1.3948
35 G A -1.1106
36 T A -0.8867
37 P A -1.0859
38 V A -0.5195
39 D A -1.5754
40 D A -2.6621
41 L A 0.0000
42 D A 0.0000
43 R A -2.5572
44 C A 0.0000
45 C A 0.0000
46 Q A -1.4713
47 T A -0.8868
48 H A 0.0000
49 D A -1.4700
50 N A -2.2107
51 C A -1.5833
52 Y A 0.0000
53 N A -3.1475
54 E A -3.4066
55 A A 0.0000
56 E A -3.1901
57 N A -2.6384
58 I A -1.1870
59 S A -0.8501
60 G A -1.1642
61 C A 0.0000
62 R A -1.4866
63 P A 0.0000
64 Y A 0.9534
65 F A 1.1793
66 K A -0.0139
67 T A 0.1508
68 Y A 0.0000
69 S A -1.1165
70 Y A -1.0987
71 E A -1.3400
72 C A -0.8893
73 T A -0.9936
74 Q A -1.5358
75 G A -1.0350
76 T A -0.6892
77 L A 0.0000
78 T A -0.8571
79 C A -1.2381
80 K A -1.8441
81 G A -1.9816
82 D A -2.6248
83 N A -1.9850
84 N A -1.8302
85 A A -0.6858
86 C A 0.0000
87 A A 0.0000
88 A A -1.1610
89 S A -0.9510
90 V A 0.0000
91 C A 0.0000
92 D A -0.8705
93 C A 0.0000
94 D A 0.0000
95 R A 0.1403
96 L A 1.2785
97 A A 0.0000
98 A A 0.0000
99 I A 1.7345
100 C A 0.6471
101 F A 0.0000
102 A A 0.4317
103 G A -0.2531
104 A A -0.8965
105 P A -1.0671
106 Y A -1.0976
107 N A -1.8943
108 D A -2.2671
109 A A -1.1475
110 N A -1.0878
111 Y A -1.1109
112 N A -1.6405
113 I A -1.5677
114 D A -2.8123
115 L A -2.7880
116 K A -2.9153
117 A A -2.3901
118 R A -3.0348
119 C A 0.0000
120 N A -2.2484
1 K B -0.8800
2 G B -0.3326
3 A B 0.4863
4 I B 1.9202
5 I B 1.4720
6 G B 0.4241
7 L B 0.0000
8 M B 0.1510

 

Laboratory of Theory of Biopolymers 2015