Project name: baaaa

Status: done

submitted: 2018-07-06 19:53:50, status changed: 2018-07-07 11:13:15
Settings
Chain sequence(s) A: KHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKP
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.1672
Maximal score value
1.5594
Average score
-0.6764
Total score value
-31.1137

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
267 K A -3.0445
268 H A -3.0747
269 Q A -2.2430
270 P A -1.4882
271 G A -1.4610
272 G A -1.4776
273 G A -1.9168
274 K A -1.7735
275 V A 0.0396
276 Q A -0.6617
277 I A 0.9720
278 I A 1.3295
279 N A -0.2096
280 K A -1.2031
281 K A -0.9961
282 L A 0.7141
283 D A -0.0958
284 L A 0.9203
285 S A -0.7219
286 N A -1.0743
287 V A 0.8586
288 Q A -0.1189
289 S A -0.9422
290 K A -1.8400
291 C A -0.3002
292 G A -0.6565
293 S A -0.9319
294 K A -2.5623
295 D A -3.1672
296 N A -2.0459
297 I A -0.6554
298 K A -2.4478
299 H A -0.9883
300 V A 0.0000
301 P A -0.2096
302 G A 0.4496
303 G A -0.2364
304 G A -0.9635
305 S A -0.2718
306 V A 1.4864
307 Q A 0.1324
308 I A 0.7580
309 V A 1.5594
310 Y A 1.1560
311 K A -1.1251
312 P A -0.5848

 

Laboratory of Theory of Biopolymers 2015