Project name: 1D7A [mutate: DA164Y, DB164Y, DC164Y, DD164Y, DL164Y, DM164Y, DN164Y, DO164Y]

Status: done

submitted: 2017-09-12 22:44:28, status changed: 2017-09-13 10:30:33
Settings
Chain sequence(s) A: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
C: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
B: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
D: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
M: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
L: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
O: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
N: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA164Y, DB164Y, DC164Y, DD164Y, DL164Y, DM164Y, DN164Y, DO164Y
Energy difference between WT (input) and mutated protein (by FoldX) 4.83082 kcal/mol
Show buried residues

Minimal score value
-3.6497
Maximal score value
0.3723
Average score
-0.7082
Total score value
-912.1902

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 G A -1.0125
8 A A -1.1391
9 R A -1.6759
10 V A 0.0000
11 A A 0.0000
12 I A 0.0000
13 V A 0.0000
14 M A 0.0000
15 G A -0.4098
16 S A -0.8068
17 K A -1.2602
18 S A -0.7257
19 D A 0.0000
20 W A -0.4072
21 A A -0.5208
22 T A -0.7162
23 M A 0.0000
24 Q A -1.0000
25 F A -0.9986
26 A A 0.0000
27 A A 0.0000
28 E A -1.6691
29 I A 0.0000
30 F A 0.0000
31 E A -1.8111
32 I A 0.2844
33 L A 0.0000
34 N A -1.5948
35 V A 0.0000
36 P A -1.2182
37 H A -1.0498
38 H A -0.4509
39 V A 0.0000
40 E A -0.1722
41 V A 0.0000
42 V A 0.0000
43 S A 0.0000
44 A A 0.0000
45 H A 0.0000
46 R A -1.5971
47 T A 0.0000
48 P A 0.0000
49 D A -1.9397
50 K A -1.2242
51 L A 0.0000
52 F A -1.3164
53 S A -1.2401
54 F A -1.0686
55 A A 0.0000
56 E A -2.5247
57 S A -2.3089
58 A A 0.0000
59 E A -3.0124
60 E A -3.3709
61 N A -3.0735
62 G A -2.3210
63 Y A 0.0000
64 Q A -1.1298
65 V A 0.0000
66 I A 0.0000
67 I A 0.0000
68 A A 0.0000
69 G A 0.0000
70 A A 0.0000
71 G A -0.4381
72 G A -0.3088
73 A A 0.0000
74 A A 0.0000
75 H A 0.0000
76 L A 0.0000
77 P A 0.0000
78 G A 0.0000
79 M A 0.0000
80 I A 0.0000
81 A A 0.0000
82 A A 0.0000
83 K A -0.9536
84 T A 0.0000
85 L A -0.5920
86 V A 0.0000
87 P A 0.0000
88 V A 0.0000
89 L A 0.0000
90 G A 0.0000
91 V A 0.0000
92 P A 0.0000
93 V A -0.6643
94 Q A -1.1914
95 S A -0.5141
96 A A -0.3035
97 A A -0.2016
98 L A 0.0000
99 S A -0.3183
100 G A 0.0000
101 V A 0.0544
102 D A 0.0000
103 S A 0.0000
104 L A 0.0000
105 Y A 0.0000
106 S A 0.0000
107 I A 0.0000
108 V A 0.0000
109 Q A -0.3272
110 M A 0.0000
111 P A -0.9950
112 R A -1.5327
113 G A 0.0000
114 I A 0.0000
115 P A 0.0000
116 V A 0.0000
117 G A 0.0000
118 T A 0.0000
119 L A 0.0000
120 A A 0.0000
121 I A 0.0000
122 G A -1.0951
123 K A -2.0170
124 A A -1.4486
125 G A 0.0000
126 A A 0.0000
127 A A 0.0000
128 N A 0.0000
129 A A 0.0000
130 A A 0.0000
131 L A 0.0000
132 L A 0.0000
133 A A 0.0000
134 A A 0.0000
135 Q A 0.0000
136 I A 0.0000
137 L A 0.0000
138 A A 0.0000
139 T A -1.1217
140 H A -1.9536
141 D A -2.3021
142 K A -3.3618
143 E A -3.4459
144 L A 0.0000
145 H A -2.6337
146 Q A -3.0482
147 R A -2.7677
148 L A 0.0000
149 N A -2.5292
150 D A -3.1085
151 W A -1.7908
152 R A -2.4793
153 K A -3.4880
154 A A -2.5518
155 Q A -2.2417
156 T A -2.7744
157 D A -3.5275
158 E A -3.4560
159 V A -1.8067
160 L A -1.3509
161 E A -2.4551
162 N A -1.4738
163 P A -0.4309
164 Y A 0.3508 mutated: DA164Y
165 P A -0.6345
166 R A -1.1355
167 G A -0.7731
7 G B -0.8952
8 A B -0.9265
9 R B -1.2396
10 V B 0.0000
11 A B 0.0000
12 I B 0.0000
13 V B 0.0000
14 M B 0.0000
15 G B -0.4351
16 S B -0.7939
17 K B -1.1618
18 S B -0.6428
19 D B 0.0000
20 W B -0.5552
21 A B -0.5101
22 T B -0.6678
23 M B 0.0000
24 Q B -1.0137
25 F B -0.8815
26 A B 0.0000
27 A B 0.0000
28 E B -1.6989
29 I B 0.0000
30 F B 0.0000
31 E B -1.9629
32 I B -0.0597
33 L B 0.0000
34 N B -1.6908
35 V B 0.0000
36 P B -1.0989
37 H B -0.9455
38 H B -0.3837
39 V B 0.0000
40 E B -0.2082
41 V B 0.0000
42 V B 0.0000
43 S B 0.0000
44 A B 0.0000
45 H B 0.0000
46 R B -1.6704
47 T B 0.0000
48 P B 0.0000
49 D B -2.0106
50 K B -1.2894
51 L B 0.0000
52 F B 0.0000
53 S B -1.3233
54 F B -1.1135
55 A B 0.0000
56 E B -2.5860
57 S B -2.3215
58 A B 0.0000
59 E B -2.9325
60 E B -3.3458
61 N B -3.0010
62 G B -2.1880
63 Y B 0.0000
64 Q B -1.0104
65 V B 0.0000
66 I B 0.0000
67 I B 0.0000
68 A B 0.0000
69 G B 0.0000
70 A B 0.0000
71 G B -0.3855
72 G B -0.2862
73 A B 0.0000
74 A B 0.0000
75 H B 0.0000
76 L B 0.0000
77 P B 0.0000
78 G B 0.0000
79 M B 0.0000
80 I B 0.0000
81 A B 0.0000
82 A B 0.0000
83 K B -1.0462
84 T B 0.0000
85 L B 0.0000
86 V B 0.0000
87 P B 0.0000
88 V B 0.0000
89 L B 0.0000
90 G B 0.0000
91 V B 0.0000
92 P B 0.0000
93 V B -0.5403
94 Q B -0.9177
95 S B -0.3994
96 A B -0.2968
97 A B -0.2860
98 L B 0.0000
99 S B -0.2329
100 G B 0.0000
101 V B 0.0774
102 D B 0.0000
103 S B 0.0000
104 L B 0.0000
105 Y B 0.0000
106 S B 0.0000
107 I B 0.0000
108 V B 0.0000
109 Q B 0.0000
110 M B 0.0000
111 P B -1.0826
112 R B -1.7460
113 G B 0.0000
114 I B 0.0000
115 P B 0.0000
116 V B 0.0000
117 G B 0.0000
118 T B 0.0000
119 L B 0.0000
120 A B 0.0000
121 I B 0.0000
122 G B 0.0000
123 K B -1.9485
124 A B -1.3842
125 G B 0.0000
126 A B 0.0000
127 A B 0.0000
128 N B 0.0000
129 A B 0.0000
130 A B 0.0000
131 L B 0.0000
132 L B 0.0000
133 A B 0.0000
134 A B 0.0000
135 Q B 0.0000
136 I B 0.0000
137 L B 0.0000
138 A B 0.0000
139 T B -1.1542
140 H B -1.9637
141 D B -2.2925
142 K B -3.3349
143 E B -3.4045
144 L B 0.0000
145 H B -2.5510
146 Q B -2.9054
147 R B -2.6400
148 L B 0.0000
149 N B -2.3957
150 D B -2.8747
151 W B -1.7361
152 R B -2.4175
153 K B -3.4106
154 A B -2.5017
155 Q B -2.1981
156 T B -2.5652
157 D B -3.5599
158 E B -3.4787
159 V B -1.8442
160 L B -1.4682
161 E B -2.5219
162 N B -1.6314
163 P B -0.4904
164 Y B 0.2924 mutated: DB164Y
165 P B -0.7025
166 R B -1.2894
167 G B -0.8276
7 G C -0.8265
8 A C -0.7992
9 R C -0.9405
10 V C 0.0000
11 A C 0.0000
12 I C 0.0000
13 V C 0.0000
14 M C 0.0000
15 G C -0.4254
16 S C -0.8527
17 K C -1.3968
18 S C -0.7865
19 D C 0.0000
20 W C -0.6519
21 A C -0.5520
22 T C 0.0000
23 M C 0.0000
24 Q C -1.0052
25 F C -0.8309
26 A C 0.0000
27 A C 0.0000
28 E C -1.7681
29 I C 0.0000
30 F C 0.0000
31 E C -1.9619
32 I C -0.0155
33 L C 0.0000
34 N C -1.6951
35 V C 0.0000
36 P C -1.1042
37 H C -0.8947
38 H C -0.3572
39 V C 0.0000
40 E C -0.2273
41 V C 0.0000
42 V C 0.0000
43 S C 0.0000
44 A C 0.0000
45 H C 0.0000
46 R C -1.5555
47 T C 0.0000
48 P C 0.0000
49 D C -2.0052
50 K C -1.2846
51 L C 0.0000
52 F C 0.0000
53 S C -1.3153
54 F C -1.0942
55 A C 0.0000
56 E C -2.5468
57 S C -2.2389
58 A C 0.0000
59 E C -2.7532
60 E C -3.2562
61 N C -2.8713
62 G C -1.9794
63 Y C -1.3494
64 Q C -0.7831
65 V C 0.0000
66 I C 0.0000
67 I C 0.0000
68 A C 0.0000
69 G C 0.0000
70 A C 0.0000
71 G C -0.3579
72 G C -0.2372
73 A C 0.0000
74 A C 0.0000
75 H C 0.0000
76 L C 0.0000
77 P C 0.0000
78 G C 0.0000
79 M C 0.0000
80 I C 0.0000
81 A C 0.0000
82 A C 0.0000
83 K C -1.0043
84 T C 0.0000
85 L C 0.0000
86 V C 0.0000
87 P C 0.0000
88 V C 0.0000
89 L C 0.0000
90 G C 0.0000
91 V C 0.0000
92 P C 0.0000
93 V C -0.5324
94 Q C -0.8881
95 S C -0.3374
96 A C -0.2049
97 A C -0.1364
98 L C 0.0133
99 S C -0.1600
100 G C 0.0000
101 V C 0.1642
102 D C 0.0000
103 S C 0.0000
104 L C 0.0000
105 Y C 0.0000
106 S C 0.0000
107 I C 0.0000
108 V C 0.0000
109 Q C -0.3768
110 M C 0.0000
111 P C -1.2013
112 R C -1.9274
113 G C -0.9929
114 I C 0.0000
115 P C 0.0000
116 V C 0.0000
117 G C 0.0000
118 T C 0.0000
119 L C 0.0000
120 A C 0.0000
121 I C 0.0000
122 G C 0.0000
123 K C -1.9428
124 A C -1.4157
125 G C 0.0000
126 A C 0.0000
127 A C 0.0000
128 N C 0.0000
129 A C 0.0000
130 A C 0.0000
131 L C 0.0000
132 L C 0.0000
133 A C 0.0000
134 A C 0.0000
135 Q C 0.0000
136 I C 0.0000
137 L C 0.0000
138 A C 0.0000
139 T C -1.1509
140 H C -1.9678
141 D C -2.4374
142 K C -3.4506
143 E C -3.5181
144 L C 0.0000
145 H C -2.7159
146 Q C -3.1223
147 R C -2.7457
148 L C 0.0000
149 N C -2.4630
150 D C -2.9176
151 W C -1.7478
152 R C -2.4396
153 K C -3.4017
154 A C -2.5025
155 Q C -2.2098
156 T C -2.7681
157 D C -3.5430
158 E C -3.4727
159 V C -1.8116
160 L C -1.3935
161 E C -2.5009
162 N C -1.6252
163 P C -0.4461
164 Y C 0.3723 mutated: DC164Y
165 P C -0.5633
166 R C -1.0574
167 G C -0.7256
7 G D -0.8952
8 A D -0.9237
9 R D -1.2160
10 V D 0.0000
11 A D 0.0000
12 I D 0.0000
13 V D 0.0000
14 M D 0.0000
15 G D -0.4458
16 S D -0.8807
17 K D -1.4291
18 S D -0.8087
19 D D 0.0000
20 W D -0.6358
21 A D -0.5482
22 T D -0.7165
23 M D 0.0000
24 Q D -0.9465
25 F D -0.8200
26 A D 0.0000
27 A D 0.0000
28 E D -1.5280
29 I D 0.0000
30 F D 0.0000
31 E D -1.7805
32 I D 0.2609
33 L D 0.0000
34 N D -1.5899
35 V D 0.0000
36 P D -1.1050
37 H D -0.9455
38 H D -0.3740
39 V D 0.0000
40 E D -0.1847
41 V D 0.0000
42 V D 0.0000
43 S D 0.0000
44 A D 0.0000
45 H D 0.0000
46 R D -1.5705
47 T D 0.0000
48 P D 0.0000
49 D D -1.9980
50 K D -1.2699
51 L D 0.0000
52 F D 0.0000
53 S D -1.3299
54 F D -1.1063
55 A D 0.0000
56 E D -2.5560
57 S D -2.2801
58 A D 0.0000
59 E D -2.7864
60 E D -3.2779
61 N D -2.9532
62 G D -2.1345
63 Y D 0.0000
64 Q D -0.9565
65 V D 0.0000
66 I D 0.0000
67 I D 0.0000
68 A D 0.0000
69 G D 0.0000
70 A D 0.0000
71 G D -0.4467
72 G D -0.3163
73 A D 0.0000
74 A D 0.0000
75 H D 0.0000
76 L D 0.0000
77 P D 0.0000
78 G D 0.0000
79 M D 0.0000
80 I D 0.0000
81 A D 0.0000
82 A D 0.0000
83 K D -1.0070
84 T D 0.0000
85 L D 0.0000
86 V D 0.0000
87 P D 0.0000
88 V D 0.0000
89 L D 0.0000
90 G D 0.0000
91 V D 0.0000
92 P D 0.0000
93 V D -0.7114
94 Q D -1.2621
95 S D -0.5390
96 A D -0.3508
97 A D -0.2989
98 L D 0.0000
99 S D -0.3381
100 G D 0.0000
101 V D 0.0548
102 D D 0.0000
103 S D 0.0000
104 L D 0.0000
105 Y D 0.0000
106 S D 0.0000
107 I D 0.0000
108 V D 0.0000
109 Q D -0.3799
110 M D 0.0000
111 P D -1.1859
112 R D -1.9455
113 G D 0.0000
114 I D 0.0000
115 P D 0.0000
116 V D 0.0000
117 G D 0.0000
118 T D 0.0000
119 L D 0.0000
120 A D 0.0000
121 I D 0.0000
122 G D -1.1324
123 K D -1.9662
124 A D -1.2785
125 G D 0.0000
126 A D 0.0000
127 A D 0.0000
128 N D 0.0000
129 A D 0.0000
130 A D 0.0000
131 L D 0.0000
132 L D 0.0000
133 A D 0.0000
134 A D 0.0000
135 Q D 0.0000
136 I D 0.0000
137 L D 0.0000
138 A D 0.0000
139 T D -1.1416
140 H D -1.9603
141 D D -2.3064
142 K D -3.3684
143 E D -3.4543
144 L D 0.0000
145 H D -2.6539
146 Q D -3.0814
147 R D -2.7779
148 L D 0.0000
149 N D -2.5491
150 D D -3.1138
151 W D -1.8085
152 R D -2.4787
153 K D -3.4896
154 A D -2.5819
155 Q D -2.2738
156 T D -2.6630
157 D D -3.6497
158 E D -3.6194
159 V D 0.0000
160 L D -1.6006
161 E D -2.6677
162 N D -1.8630
163 P D -0.5868
164 Y D 0.2628 mutated: DD164Y
165 P D -0.6358
166 R D -1.2613
167 G D -0.8300
7 G L -0.9273
8 A L -1.0073
9 R L -1.3519
10 V L 0.0000
11 A L 0.0000
12 I L 0.0000
13 V L 0.0000
14 M L 0.0000
15 G L -0.3870
16 S L -0.7064
17 K L -1.1199
18 S L -0.5998
19 D L 0.0000
20 W L -0.6204
21 A L -0.3515
22 T L 0.0000
23 M L 0.0000
24 Q L -1.1732
25 F L -0.8953
26 A L 0.0000
27 A L 0.0000
28 E L -1.9509
29 I L 0.0000
30 F L 0.0000
31 E L -2.1236
32 I L -0.1315
33 L L 0.0000
34 N L -1.7670
35 V L 0.0000
36 P L -1.1849
37 H L -1.0400
38 H L -0.4482
39 V L 0.0000
40 E L -0.2602
41 V L 0.0000
42 V L 0.0000
43 S L 0.0000
44 A L 0.0000
45 H L 0.0000
46 R L -1.5784
47 T L 0.0000
48 P L 0.0000
49 D L -2.0017
50 K L -1.3039
51 L L 0.0000
52 F L -1.4146
53 S L -1.3420
54 F L 0.0000
55 A L 0.0000
56 E L -2.5731
57 S L -2.3147
58 A L 0.0000
59 E L -2.9613
60 E L -3.3640
61 N L -3.0053
62 G L -2.1722
63 Y L 0.0000
64 Q L -1.1772
65 V L 0.0000
66 I L 0.0000
67 I L 0.0000
68 A L 0.0000
69 G L 0.0000
70 A L 0.0000
71 G L -0.5402
72 G L -0.3719
73 A L 0.0000
74 A L 0.0000
75 H L 0.0000
76 L L 0.0000
77 P L 0.0000
78 G L 0.0000
79 M L 0.0000
80 I L 0.0000
81 A L 0.0000
82 A L 0.0000
83 K L -1.0025
84 T L 0.0000
85 L L 0.0000
86 V L 0.0000
87 P L 0.0000
88 V L 0.0000
89 L L 0.0000
90 G L 0.0000
91 V L 0.0000
92 P L 0.0000
93 V L -0.7291
94 Q L -1.3645
95 S L -0.6347
96 A L -0.4010
97 A L -0.3655
98 L L 0.0000
99 S L -0.4173
100 G L 0.0000
101 V L -0.0115
102 D L 0.0000
103 S L 0.0000
104 L L 0.0000
105 Y L 0.0000
106 S L 0.0000
107 I L 0.0000
108 V L 0.0000
109 Q L -0.4000
110 M L 0.0000
111 P L -1.2453
112 R L -2.1740
113 G L 0.0000
114 I L 0.0000
115 P L 0.0000
116 V L 0.0000
117 G L 0.0000
118 T L 0.0000
119 L L 0.0000
120 A L 0.0000
121 I L 0.0000
122 G L 0.0000
123 K L -1.7834
124 A L -1.1634
125 G L 0.0000
126 A L 0.0000
127 A L 0.0000
128 N L 0.0000
129 A L 0.0000
130 A L 0.0000
131 L L 0.0000
132 L L 0.0000
133 A L 0.0000
134 A L 0.0000
135 Q L 0.0000
136 I L 0.0000
137 L L 0.0000
138 A L 0.0000
139 T L -1.1200
140 H L -1.9753
141 D L -2.3790
142 K L -3.4062
143 E L -3.5905
144 L L 0.0000
145 H L -2.8736
146 Q L -3.5074
147 R L -3.0383
148 L L 0.0000
149 N L -3.3853
150 D L -3.4771
151 W L -1.9717
152 R L -2.3857
153 K L -3.3092
154 A L -2.2158
155 Q L -1.8446
156 T L -2.1709
157 D L -2.3221
158 E L -2.9437
159 V L 0.0000
160 L L -1.0674
161 E L -2.3152
162 N L -1.7680
163 P L -0.6121
164 Y L 0.2744 mutated: DL164Y
165 P L -0.6280
166 R L -0.9629
167 G L -0.6394
7 G M -0.9045
8 A M -0.9766
9 R M -1.3016
10 V M 0.0000
11 A M 0.0000
12 I M 0.0000
13 V M 0.0000
14 M M 0.0000
15 G M -0.3972
16 S M -0.7017
17 K M -1.1023
18 S M -0.5768
19 D M 0.0000
20 W M -0.5860
21 A M -0.3064
22 T M -0.5811
23 M M 0.0000
24 Q M -1.0963
25 F M -0.7346
26 A M 0.0000
27 A M 0.0000
28 E M -1.8188
29 I M 0.0000
30 F M 0.0000
31 E M -2.0779
32 I M -0.0804
33 L M 0.0000
34 N M -1.7383
35 V M 0.0000
36 P M -1.1444
37 H M -1.0312
38 H M -0.4524
39 V M 0.0000
40 E M -0.2732
41 V M 0.0000
42 V M 0.0000
43 S M 0.0000
44 A M 0.0000
45 H M 0.0000
46 R M -1.5805
47 T M 0.0000
48 P M 0.0000
49 D M -1.9674
50 K M -1.2411
51 L M 0.0000
52 F M -1.3646
53 S M -1.2545
54 F M -1.0893
55 A M 0.0000
56 E M -2.5573
57 S M -2.2889
58 A M 0.0000
59 E M -3.0217
60 E M -3.3816
61 N M -3.0141
62 G M -2.2169
63 Y M 0.0000
64 Q M -1.0746
65 V M 0.0000
66 I M 0.0000
67 I M 0.0000
68 A M 0.0000
69 G M 0.0000
70 A M 0.0000
71 G M -0.5150
72 G M -0.3622
73 A M 0.0000
74 A M 0.0000
75 H M 0.0000
76 L M 0.0000
77 P M 0.0000
78 G M 0.0000
79 M M 0.0000
80 I M 0.0000
81 A M 0.0000
82 A M 0.0000
83 K M -1.0916
84 T M 0.0000
85 L M 0.0000
86 V M 0.0000
87 P M 0.0000
88 V M 0.0000
89 L M 0.0000
90 G M 0.0000
91 V M 0.0000
92 P M 0.0000
93 V M -0.6981
94 Q M -1.3102
95 S M -0.6144
96 A M -0.4056
97 A M -0.3833
98 L M 0.0000
99 S M -0.4197
100 G M 0.0000
101 V M -0.0074
102 D M 0.0000
103 S M 0.0000
104 L M 0.0000
105 Y M 0.0000
106 S M 0.0000
107 I M 0.0000
108 V M 0.0000
109 Q M -0.3576
110 M M 0.0000
111 P M -1.1727
112 R M -2.0295
113 G M -1.0277
114 I M 0.0000
115 P M 0.0000
116 V M 0.0000
117 G M 0.0000
118 T M 0.0000
119 L M 0.0000
120 A M 0.0000
121 I M 0.0000
122 G M 0.0000
123 K M -1.6282
124 A M -1.1487
125 G M 0.0000
126 A M 0.0000
127 A M 0.0000
128 N M 0.0000
129 A M 0.0000
130 A M 0.0000
131 L M 0.0000
132 L M 0.0000
133 A M 0.0000
134 A M 0.0000
135 Q M 0.0000
136 I M 0.0000
137 L M 0.0000
138 A M 0.0000
139 T M -1.1234
140 H M -1.9521
141 D M -2.3424
142 K M -3.3998
143 E M -3.4931
144 L M 0.0000
145 H M -2.6720
146 Q M -3.2325
147 R M -2.7404
148 L M 0.0000
149 N M -2.5043
150 D M -3.0945
151 W M -1.8197
152 R M -2.2780
153 K M -3.4438
154 A M -2.5488
155 Q M -2.2768
156 T M -2.6467
157 D M -3.5741
158 E M -3.5294
159 V M 0.0000
160 L M -1.4727
161 E M -2.5668
162 N M -1.7857
163 P M -0.5657
164 Y M 0.1090 mutated: DM164Y
165 P M -0.9150
166 R M -1.9248
167 G M -1.1585
7 G N -0.8976
8 A N -0.9590
9 R N -1.2778
10 V N 0.0000
11 A N 0.0000
12 I N 0.0000
13 V N 0.0000
14 M N 0.0000
15 G N -0.4032
16 S N -0.6780
17 K N -1.1386
18 S N -0.6122
19 D N 0.0000
20 W N -0.6253
21 A N -0.3889
22 T N -0.7440
23 M N 0.0000
24 Q N -1.2229
25 F N -1.0317
26 A N 0.0000
27 A N 0.0000
28 E N -2.0531
29 I N 0.0000
30 F N 0.0000
31 E N -2.1782
32 I N -0.2128
33 L N 0.0000
34 N N -1.7861
35 V N 0.0000
36 P N -1.1333
37 H N -0.9997
38 H N -0.4182
39 V N 0.0000
40 E N -0.2755
41 V N 0.0000
42 V N 0.0000
43 S N 0.0000
44 A N 0.0000
45 H N 0.0000
46 R N -1.6312
47 T N 0.0000
48 P N -1.1357
49 D N -2.0174
50 K N -1.3059
51 L N 0.0000
52 F N -1.4310
53 S N -1.3413
54 F N 0.0000
55 A N 0.0000
56 E N -2.5907
57 S N -2.3267
58 A N 0.0000
59 E N -3.0025
60 E N -3.3911
61 N N -3.0112
62 G N -2.1786
63 Y N 0.0000
64 Q N -1.2194
65 V N 0.0000
66 I N 0.0000
67 I N 0.0000
68 A N 0.0000
69 G N 0.0000
70 A N 0.0000
71 G N -0.4672
72 G N -0.3002
73 A N 0.0000
74 A N 0.0000
75 H N 0.0000
76 L N 0.0000
77 P N 0.0000
78 G N 0.0000
79 M N 0.0000
80 I N 0.0000
81 A N 0.0000
82 A N 0.0000
83 K N -1.0637
84 T N -0.8583
85 L N 0.0000
86 V N 0.0000
87 P N 0.0000
88 V N 0.0000
89 L N 0.0000
90 G N 0.0000
91 V N 0.0000
92 P N 0.0000
93 V N -0.7204
94 Q N -1.3087
95 S N -0.5629
96 A N -0.3829
97 A N -0.3494
98 L N 0.0000
99 S N -0.3846
100 G N 0.0000
101 V N 0.0012
102 D N 0.0000
103 S N 0.0000
104 L N 0.0000
105 Y N 0.0000
106 S N 0.0000
107 I N 0.0000
108 V N 0.0000
109 Q N -0.3483
110 M N 0.0000
111 P N -1.0553
112 R N -1.7045
113 G N 0.0000
114 I N 0.0000
115 P N 0.0000
116 V N 0.0000
117 G N 0.0000
118 T N 0.0000
119 L N 0.0000
120 A N 0.0000
121 I N 0.0000
122 G N -1.1531
123 K N -2.0399
124 A N -1.4117
125 G N 0.0000
126 A N 0.0000
127 A N 0.0000
128 N N 0.0000
129 A N 0.0000
130 A N 0.0000
131 L N 0.0000
132 L N 0.0000
133 A N 0.0000
134 A N 0.0000
135 Q N 0.0000
136 I N 0.0000
137 L N 0.0000
138 A N 0.0000
139 T N -1.1014
140 H N -1.9527
141 D N -2.3457
142 K N -3.4062
143 E N -3.5053
144 L N 0.0000
145 H N -2.6309
146 Q N -3.1735
147 R N -2.6449
148 L N 0.0000
149 N N -2.2970
150 D N -2.6925
151 W N -1.6098
152 R N -2.0711
153 K N -3.0782
154 A N -2.3420
155 Q N -2.1431
156 T N -2.5142
157 D N -3.5104
158 E N -3.4857
159 V N 0.0000
160 L N -1.4920
161 E N -2.5669
162 N N -1.7692
163 P N -0.5629
164 Y N 0.1113 mutated: DN164Y
165 P N -0.9250
166 R N -1.9308
167 G N -1.1595
7 G O -0.8621
8 A O -0.8829
9 R O -1.1379
10 V O 0.0000
11 A O 0.0000
12 I O 0.0000
13 V O 0.0000
14 M O 0.0000
15 G O -0.5321
16 S O -0.9812
17 K O -1.6361
18 S O -0.8934
19 D O 0.0000
20 W O -0.7707
21 A O -0.4828
22 T O -0.7490
23 M O 0.0000
24 Q O -1.0272
25 F O -0.9738
26 A O 0.0000
27 A O 0.0000
28 E O -1.9082
29 I O 0.0000
30 F O 0.0000
31 E O -2.1172
32 I O -0.1593
33 L O 0.0000
34 N O -1.7724
35 V O 0.0000
36 P O -1.0991
37 H O -0.9072
38 H O -0.3503
39 V O 0.0000
40 E O -0.2304
41 V O 0.0000
42 V O 0.0000
43 S O 0.0000
44 A O 0.0000
45 H O 0.0000
46 R O -1.4034
47 T O 0.0000
48 P O 0.0000
49 D O -1.9714
50 K O -1.2784
51 L O 0.0000
52 F O -1.3794
53 S O -1.3261
54 F O 0.0000
55 A O 0.0000
56 E O -2.5612
57 S O -2.3023
58 A O 0.0000
59 E O -2.9011
60 E O -3.3562
61 N O -2.9785
62 G O -2.1399
63 Y O 0.0000
64 Q O -1.1849
65 V O 0.0000
66 I O 0.0000
67 I O 0.0000
68 A O 0.0000
69 G O 0.0000
70 A O 0.0000
71 G O -0.5096
72 G O -0.3493
73 A O 0.0000
74 A O 0.0000
75 H O 0.0000
76 L O 0.0000
77 P O 0.0000
78 G O 0.0000
79 M O 0.0000
80 I O 0.0000
81 A O 0.0000
82 A O 0.0000
83 K O -1.0058
84 T O 0.0000
85 L O 0.0000
86 V O 0.0000
87 P O 0.0000
88 V O 0.0000
89 L O 0.0000
90 G O 0.0000
91 V O 0.0000
92 P O 0.0000
93 V O -0.7693
94 Q O -1.3581
95 S O -0.6024
96 A O -0.4028
97 A O -0.3658
98 L O 0.0000
99 S O -0.4012
100 G O 0.0000
101 V O 0.0018
102 D O 0.0000
103 S O 0.0000
104 L O 0.0000
105 Y O 0.0000
106 S O 0.0000
107 I O 0.0000
108 V O 0.0000
109 Q O -0.3917
110 M O 0.0000
111 P O -1.2621
112 R O -2.2006
113 G O -1.1218
114 I O 0.0000
115 P O 0.0000
116 V O 0.0000
117 G O 0.0000
118 T O 0.0000
119 L O 0.0000
120 A O 0.0000
121 I O 0.0000
122 G O -1.1681
123 K O -2.0422
124 A O -1.4138
125 G O 0.0000
126 A O 0.0000
127 A O 0.0000
128 N O 0.0000
129 A O 0.0000
130 A O 0.0000
131 L O 0.0000
132 L O 0.0000
133 A O 0.0000
134 A O 0.0000
135 Q O 0.0000
136 I O 0.0000
137 L O 0.0000
138 A O 0.0000
139 T O -1.0692
140 H O -1.8897
141 D O -2.3492
142 K O -3.3992
143 E O -3.4951
144 L O 0.0000
145 H O -2.6187
146 Q O -3.1530
147 R O -2.6987
148 L O 0.0000
149 N O -2.3163
150 D O -2.7971
151 W O -1.6807
152 R O -2.1326
153 K O -3.1841
154 A O -2.3867
155 Q O -2.1595
156 T O -2.5442
157 D O -3.5144
158 E O -3.4709
159 V O 0.0000
160 L O -1.4607
161 E O -2.5358
162 N O -1.7224
163 P O -0.5365
164 Y O 0.1225 mutated: DO164Y
165 P O -0.9118
166 R O -1.9247
167 G O -1.1566

 

Laboratory of Theory of Biopolymers 2015