Project name: 1D7A [mutate: DA164Y, DB164Y, DC164Y, DD164Y, DL164Y, DM164Y, DN164Y, DO164Y]

Status: done

submitted: 2017-09-12 22:44:28, status changed: 2017-09-13 10:30:33
Settings
Chain sequence(s) A: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
C: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
B: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
D: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
M: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
L: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
O: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
N: GARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA164Y, DB164Y, DC164Y, DD164Y, DL164Y, DM164Y, DN164Y, DO164Y
Energy difference between WT (input) and mutated protein (by FoldX) 4.83082 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.6497
Maximal score value
0.3723
Average score
-0.7082
Total score value
-912.1902

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 G A -1.0125
8 A A -1.1391
9 R A -1.6759
10 V A 0.0000
11 A A 0.0000
12 I A 0.0000
13 V A 0.0000
14 M A 0.0000
15 G A -0.4098
16 S A -0.8068
17 K A -1.2602
18 S A -0.7257
19 D A 0.0000
20 W A -0.4072
21 A A -0.5208
22 T A -0.7162
23 M A 0.0000
24 Q A -1.0000
25 F A -0.9986
26 A A 0.0000
27 A A 0.0000
28 E A -1.6691
29 I A 0.0000
30 F A 0.0000
31 E A -1.8111
32 I A 0.2844
33 L A 0.0000
34 N A -1.5948
35 V A 0.0000
36 P A -1.2182
37 H A -1.0498
38 H A -0.4509
39 V A 0.0000
40 E A -0.1722
41 V A 0.0000
42 V A 0.0000
43 S A 0.0000
44 A A 0.0000
45 H A 0.0000
46 R A -1.5971
47 T A 0.0000
48 P A 0.0000
49 D A -1.9397
50 K A -1.2242
51 L A 0.0000
52 F A -1.3164
53 S A -1.2401
54 F A -1.0686
55 A A 0.0000
56 E A -2.5247
57 S A -2.3089
58 A A 0.0000
59 E A -3.0124
60 E A -3.3709
61 N A -3.0735
62 G A -2.3210
63 Y A 0.0000
64 Q A -1.1298
65 V A 0.0000
66 I A 0.0000
67 I A 0.0000
68 A A 0.0000
69 G A 0.0000
70 A A 0.0000
71 G A -0.4381
72 G A -0.3088
73 A A 0.0000
74 A A 0.0000
75 H A 0.0000
76 L A 0.0000
77 P A 0.0000
78 G A 0.0000
79 M A 0.0000
80 I A 0.0000
81 A A 0.0000
82 A A 0.0000
83 K A -0.9536
84 T A 0.0000
85 L A -0.5920
86 V A 0.0000
87 P A 0.0000
88 V A 0.0000
89 L A 0.0000
90 G A 0.0000
91 V A 0.0000
92 P A 0.0000
93 V A -0.6643
94 Q A -1.1914
95 S A -0.5141
96 A A -0.3035
97 A A -0.2016
98 L A 0.0000
99 S A -0.3183
100 G A 0.0000
101 V A 0.0544
102 D A 0.0000
103 S A 0.0000
104 L A 0.0000
105 Y A 0.0000
106 S A 0.0000
107 I A 0.0000
108 V A 0.0000
109 Q A -0.3272
110 M A 0.0000
111 P A -0.9950
112 R A -1.5327
113 G A 0.0000
114 I A 0.0000
115 P A 0.0000
116 V A 0.0000
117 G A 0.0000
118 T A 0.0000
119 L A 0.0000
120 A A 0.0000
121 I A 0.0000
122 G A -1.0951
123 K A -2.0170
124 A A -1.4486
125 G A 0.0000
126 A A 0.0000
127 A A 0.0000
128 N A 0.0000
129 A A 0.0000
130 A A 0.0000
131 L A 0.0000
132 L A 0.0000
133 A A 0.0000
134 A A 0.0000
135 Q A 0.0000
136 I A 0.0000
137 L A 0.0000
138 A A 0.0000
139 T A -1.1217
140 H A -1.9536
141 D A -2.3021
142 K A -3.3618
143 E A -3.4459
144 L A 0.0000
145 H A -2.6337
146 Q A -3.0482
147 R A -2.7677
148 L A 0.0000
149 N A -2.5292
150 D A -3.1085
151 W A -1.7908
152 R A -2.4793
153 K A -3.4880
154 A A -2.5518
155 Q A -2.2417
156 T A -2.7744
157 D A -3.5275
158 E A -3.4560
159 V A -1.8067
160 L A -1.3509
161 E A -2.4551
162 N A -1.4738
163 P A -0.4309
164 Y A 0.3508 mutated: DA164Y
165 P A -0.6345
166 R A -1.1355
167 G A -0.7731
7 G B -0.8952
8 A B -0.9265
9 R B -1.2396
10 V B 0.0000
11 A B 0.0000
12 I B 0.0000
13 V B 0.0000
14 M B 0.0000
15 G B -0.4351
16 S B -0.7939
17 K B -1.1618
18 S B -0.6428
19 D B 0.0000
20 W B -0.5552
21 A B -0.5101
22 T B -0.6678
23 M B 0.0000
24 Q B -1.0137
25 F B -0.8815
26 A B 0.0000
27 A B 0.0000
28 E B -1.6989
29 I B 0.0000
30 F B 0.0000
31 E B -1.9629
32 I B -0.0597
33 L B 0.0000
34 N B -1.6908
35 V B 0.0000
36 P B -1.0989
37 H B -0.9455
38 H B -0.3837
39 V B 0.0000
40 E B -0.2082
41 V B 0.0000
42 V B 0.0000
43 S B 0.0000
44 A B 0.0000
45 H B 0.0000
46 R B -1.6704
47 T B 0.0000
48 P B 0.0000
49 D B -2.0106
50 K B -1.2894
51 L B 0.0000
52 F B 0.0000
53 S B -1.3233
54 F B -1.1135
55 A B 0.0000
56 E B -2.5860
57 S B -2.3215
58 A B 0.0000
59 E B -2.9325
60 E B -3.3458
61 N B -3.0010
62 G B -2.1880
63 Y B 0.0000
64 Q B -1.0104
65 V B 0.0000
66 I B 0.0000
67 I B 0.0000
68 A B 0.0000
69 G B 0.0000
70 A B 0.0000
71 G B -0.3855
72 G B -0.2862
73 A B 0.0000
74 A B 0.0000
75 H B 0.0000
76 L B 0.0000
77 P B 0.0000
78 G B 0.0000
79 M B 0.0000
80 I B 0.0000
81 A B 0.0000
82 A B 0.0000
83 K B -1.0462
84 T B 0.0000
85 L B 0.0000
86 V B 0.0000
87 P B 0.0000
88 V B 0.0000
89 L B 0.0000
90 G B 0.0000
91 V B 0.0000
92 P B 0.0000
93 V B -0.5403
94 Q B -0.9177
95 S B -0.3994
96 A B -0.2968
97 A B -0.2860
98 L B 0.0000
99 S B -0.2329
100 G B 0.0000
101 V B 0.0774
102 D B 0.0000
103 S B 0.0000
104 L B 0.0000
105 Y B 0.0000
106 S B 0.0000
107 I B 0.0000
108 V B 0.0000
109 Q B 0.0000
110 M B 0.0000
111 P B -1.0826
112 R B -1.7460
113 G B 0.0000
114 I B 0.0000
115 P B 0.0000
116 V B 0.0000
117 G B 0.0000
118 T B 0.0000
119 L B 0.0000
120 A B 0.0000
121 I B 0.0000
122 G B 0.0000
123 K B -1.9485
124 A B -1.3842
125 G B 0.0000
126 A B 0.0000
127 A B 0.0000
128 N B 0.0000
129 A B 0.0000
130 A B 0.0000
131 L B 0.0000
132 L B 0.0000
133 A B 0.0000
134 A B 0.0000
135 Q B 0.0000
136 I B 0.0000
137 L B 0.0000
138 A B 0.0000
139 T B -1.1542
140 H B -1.9637
141 D B -2.2925
142 K B -3.3349
143 E B -3.4045
144 L B 0.0000
145 H B -2.5510
146 Q B -2.9054
147 R B -2.6400
148 L B 0.0000
149 N B -2.3957
150 D B -2.8747
151 W B -1.7361
152 R B -2.4175
153 K B -3.4106
154 A B -2.5017
155 Q B -2.1981
156 T B -2.5652
157 D B -3.5599
158 E B -3.4787
159 V B -1.8442
160 L B -1.4682
161 E B -2.5219
162 N B -1.6314
163 P B -0.4904
164 Y B 0.2924 mutated: DB164Y
165 P B -0.7025
166 R B -1.2894
167 G B -0.8276
7 G C -0.8265
8 A C -0.7992
9 R C -0.9405
10 V C 0.0000
11 A C 0.0000
12 I C 0.0000
13 V C 0.0000
14 M C 0.0000
15 G C -0.4254
16 S C -0.8527
17 K C -1.3968
18 S C -0.7865
19 D C 0.0000
20 W C -0.6519
21 A C -0.5520
22 T C 0.0000
23 M C 0.0000
24 Q C -1.0052
25 F C -0.8309
26 A C 0.0000
27 A C 0.0000
28 E C -1.7681
29 I C 0.0000
30 F C 0.0000
31 E C -1.9619
32 I C -0.0155
33 L C 0.0000
34 N C -1.6951
35 V C 0.0000
36 P C -1.1042
37 H C -0.8947
38 H C -0.3572
39 V C 0.0000
40 E C -0.2273
41 V C 0.0000
42 V C 0.0000
43 S C 0.0000
44 A C 0.0000
45 H C 0.0000
46 R C -1.5555
47 T C 0.0000
48 P C 0.0000
49 D C -2.0052
50 K C -1.2846
51 L C 0.0000
52 F C 0.0000
53 S C -1.3153
54 F C -1.0942
55 A C 0.0000
56 E C -2.5468
57 S C -2.2389
58 A C 0.0000
59 E C -2.7532
60 E C -3.2562
61 N C -2.8713
62 G C -1.9794
63 Y C -1.3494
64 Q C -0.7831
65 V C 0.0000
66 I C 0.0000
67 I C 0.0000
68 A C 0.0000
69 G C 0.0000
70 A C 0.0000
71 G C -0.3579
72 G C -0.2372
73 A C 0.0000
74 A C 0.0000
75 H C 0.0000
76 L C 0.0000
77 P C 0.0000
78 G C 0.0000
79 M C 0.0000
80 I C 0.0000
81 A C 0.0000
82 A C 0.0000
83 K C -1.0043
84 T C 0.0000
85 L C 0.0000
86 V C 0.0000
87 P C 0.0000
88 V C 0.0000
89 L C 0.0000
90 G C 0.0000
91 V C 0.0000
92 P C 0.0000
93 V C -0.5324
94 Q C -0.8881
95 S C -0.3374
96 A C -0.2049
97 A C -0.1364
98 L C 0.0133
99 S C -0.1600
100 G C 0.0000
101 V C 0.1642
102 D C 0.0000
103 S C 0.0000
104 L C 0.0000
105 Y C 0.0000
106 S C 0.0000
107 I C 0.0000
108 V C 0.0000
109 Q C -0.3768
110 M C 0.0000
111 P C -1.2013
112 R C -1.9274
113 G C -0.9929
114 I C 0.0000
115 P C 0.0000
116 V C 0.0000
117 G C 0.0000
118 T C 0.0000
119 L C 0.0000
120 A C 0.0000
121 I C 0.0000
122 G C 0.0000
123 K C -1.9428
124 A C -1.4157
125 G C 0.0000
126 A C 0.0000
127 A C 0.0000
128 N C 0.0000
129 A C 0.0000
130 A C 0.0000
131 L C 0.0000
132 L C 0.0000
133 A C 0.0000
134 A C 0.0000
135 Q C 0.0000
136 I C 0.0000
137 L C 0.0000
138 A C 0.0000
139 T C -1.1509
140 H C -1.9678
141 D C -2.4374
142 K C -3.4506
143 E C -3.5181
144 L C 0.0000
145 H C -2.7159
146 Q C -3.1223
147 R C -2.7457
148 L C 0.0000
149 N C -2.4630
150 D C -2.9176
151 W C -1.7478
152 R C -2.4396
153 K C -3.4017
154 A C -2.5025
155 Q C -2.2098
156 T C -2.7681
157 D C -3.5430
158 E C -3.4727
159 V C -1.8116
160 L C -1.3935
161 E C -2.5009
162 N C -1.6252
163 P C -0.4461
164 Y C 0.3723 mutated: DC164Y
165 P C -0.5633
166 R C -1.0574
167 G C -0.7256
7 G D -0.8952
8 A D -0.9237
9 R D -1.2160
10 V D 0.0000
11 A D 0.0000
12 I D 0.0000
13 V D 0.0000
14 M D 0.0000
15 G D -0.4458
16 S D -0.8807
17 K D -1.4291
18 S D -0.8087
19 D D 0.0000
20 W D -0.6358
21 A D -0.5482
22 T D -0.7165
23 M D 0.0000
24 Q D -0.9465
25 F D -0.8200
26 A D 0.0000
27 A D 0.0000
28 E D -1.5280
29 I D 0.0000
30 F D 0.0000
31 E D -1.7805
32 I D 0.2609
33 L D 0.0000
34 N D -1.5899
35 V D 0.0000
36 P D -1.1050
37 H D -0.9455
38 H D -0.3740
39 V D 0.0000
40 E D -0.1847
41 V D 0.0000
42 V D 0.0000
43 S D 0.0000
44 A D 0.0000
45 H D 0.0000
46 R D -1.5705
47 T D 0.0000
48 P D 0.0000
49 D D -1.9980
50 K D -1.2699
51 L D 0.0000
52 F D 0.0000
53 S D -1.3299
54 F D -1.1063
55 A D 0.0000
56 E D -2.5560
57 S D -2.2801
58 A D 0.0000
59 E D -2.7864
60 E D -3.2779
61 N D -2.9532
62 G D -2.1345
63 Y D 0.0000
64 Q D -0.9565
65 V D 0.0000
66 I D 0.0000
67 I D 0.0000
68 A D 0.0000
69 G D 0.0000
70 A D 0.0000
71 G D -0.4467
72 G D -0.3163
73 A D 0.0000
74 A D 0.0000
75 H D 0.0000
76 L D 0.0000
77 P D 0.0000
78 G D 0.0000
79 M D 0.0000
80 I D 0.0000
81 A D 0.0000
82 A D 0.0000
83 K D -1.0070
84 T D 0.0000
85 L D 0.0000
86 V D 0.0000
87 P D 0.0000
88 V D 0.0000
89 L D 0.0000
90 G D 0.0000
91 V D 0.0000
92 P D 0.0000
93 V D -0.7114
94 Q D -1.2621
95 S D -0.5390
96 A D -0.3508
97 A D -0.2989
98 L D 0.0000
99 S D -0.3381
100 G D 0.0000
101 V D 0.0548
102 D D 0.0000
103 S D 0.0000
104 L D 0.0000
105 Y D 0.0000
106 S D 0.0000
107 I D 0.0000
108 V D 0.0000
109 Q D -0.3799
110 M D 0.0000
111 P D -1.1859
112 R D -1.9455
113 G D 0.0000
114 I D 0.0000
115 P D 0.0000
116 V D 0.0000
117 G D 0.0000
118 T D 0.0000
119 L D 0.0000
120 A D 0.0000
121 I D 0.0000
122 G D -1.1324
123 K D -1.9662
124 A D -1.2785
125 G D 0.0000
126 A D 0.0000
127 A D 0.0000
128 N D 0.0000
129 A D 0.0000
130 A D 0.0000
131 L D 0.0000
132 L D 0.0000
133 A D 0.0000
134 A D 0.0000
135 Q D 0.0000
136 I D 0.0000
137 L D 0.0000
138 A D 0.0000
139 T D -1.1416
140 H D -1.9603
141 D D -2.3064
142 K D -3.3684
143 E D -3.4543
144 L D 0.0000
145 H D -2.6539
146 Q D -3.0814
147 R D -2.7779
148 L D 0.0000
149 N D -2.5491
150 D D -3.1138
151 W D -1.8085
152 R D -2.4787
153 K D -3.4896
154 A D -2.5819
155 Q D -2.2738
156 T D -2.6630
157 D D -3.6497
158 E D -3.6194
159 V D 0.0000
160 L D -1.6006
161 E D -2.6677
162 N D -1.8630
163 P D -0.5868
164 Y D 0.2628 mutated: DD164Y
165 P D -0.6358
166 R D -1.2613
167 G D -0.8300
7 G L -0.9273
8 A L -1.0073
9 R L -1.3519
10 V L 0.0000
11 A L 0.0000
12 I L 0.0000
13 V L 0.0000
14 M L 0.0000
15 G L -0.3870
16 S L -0.7064
17 K L -1.1199
18 S L -0.5998
19 D L 0.0000
20 W L -0.6204
21 A L -0.3515
22 T L 0.0000
23 M L 0.0000
24 Q L -1.1732
25 F L -0.8953
26 A L 0.0000
27 A L 0.0000
28 E L -1.9509
29 I L 0.0000
30 F L 0.0000
31 E L -2.1236
32 I L -0.1315
33 L L 0.0000
34 N L -1.7670
35 V L 0.0000
36 P L -1.1849
37 H L -1.0400
38 H L -0.4482
39 V L 0.0000
40 E L -0.2602
41 V L 0.0000
42 V L 0.0000
43 S L 0.0000
44 A L 0.0000
45 H L 0.0000
46 R L -1.5784
47 T L 0.0000
48 P L 0.0000
49 D L -2.0017
50 K L -1.3039
51 L L 0.0000
52 F L -1.4146
53 S L -1.3420
54 F L 0.0000
55 A L 0.0000
56 E L -2.5731
57 S L -2.3147
58 A L 0.0000
59 E L -2.9613
60 E L -3.3640
61 N L -3.0053
62 G L -2.1722
63 Y L 0.0000
64 Q L -1.1772
65 V L 0.0000
66 I L 0.0000
67 I L 0.0000
68 A L 0.0000
69 G L 0.0000
70 A L 0.0000
71 G L -0.5402
72 G L -0.3719
73 A L 0.0000
74 A L 0.0000
75 H L 0.0000
76 L L 0.0000
77 P L 0.0000
78 G L 0.0000
79 M L 0.0000
80 I L 0.0000
81 A L 0.0000
82 A L 0.0000
83 K L -1.0025
84 T L 0.0000
85 L L 0.0000
86 V L 0.0000
87 P L 0.0000
88 V L 0.0000
89 L L 0.0000
90 G L 0.0000
91 V L 0.0000
92 P L 0.0000
93 V L -0.7291
94 Q L -1.3645
95 S L -0.6347
96 A L -0.4010
97 A L -0.3655
98 L L 0.0000
99 S L -0.4173
100 G L 0.0000
101 V L -0.0115
102 D L 0.0000
103 S L 0.0000
104 L L 0.0000
105 Y L 0.0000
106 S L 0.0000
107 I L 0.0000
108 V L 0.0000
109 Q L -0.4000
110 M L 0.0000
111 P L -1.2453
112 R L -2.1740
113 G L 0.0000
114 I L 0.0000
115 P L 0.0000
116 V L 0.0000
117 G L 0.0000
118 T L 0.0000
119 L L 0.0000
120 A L 0.0000
121 I L 0.0000
122 G L 0.0000
123 K L -1.7834
124 A L -1.1634
125 G L 0.0000
126 A L 0.0000
127 A L 0.0000
128 N L 0.0000
129 A L 0.0000
130 A L 0.0000
131 L L 0.0000
132 L L 0.0000
133 A L 0.0000
134 A L 0.0000
135 Q L 0.0000
136 I L 0.0000
137 L L 0.0000
138 A L 0.0000
139 T L -1.1200
140 H L -1.9753
141 D L -2.3790
142 K L -3.4062
143 E L -3.5905
144 L L 0.0000
145 H L -2.8736
146 Q L -3.5074
147 R L -3.0383
148 L L 0.0000
149 N L -3.3853
150 D L -3.4771
151 W L -1.9717
152 R L -2.3857
153 K L -3.3092
154 A L -2.2158
155 Q L -1.8446
156 T L -2.1709
157 D L -2.3221
158 E L -2.9437
159 V L 0.0000
160 L L -1.0674
161 E L -2.3152
162 N L -1.7680
163 P L -0.6121
164 Y L 0.2744 mutated: DL164Y
165 P L -0.6280
166 R L -0.9629
167 G L -0.6394
7 G M -0.9045
8 A M -0.9766
9 R M -1.3016
10 V M 0.0000
11 A M 0.0000
12 I M 0.0000
13 V M 0.0000
14 M M 0.0000
15 G M -0.3972
16 S M -0.7017
17 K M -1.1023
18 S M -0.5768
19 D M 0.0000
20 W M -0.5860
21 A M -0.3064
22 T M -0.5811
23 M M 0.0000
24 Q M -1.0963
25 F M -0.7346
26 A M 0.0000
27 A M 0.0000
28 E M -1.8188
29 I M 0.0000
30 F M 0.0000
31 E M -2.0779
32 I M -0.0804
33 L M 0.0000
34 N M -1.7383
35 V M 0.0000
36 P M -1.1444
37 H M -1.0312
38 H M -0.4524
39 V M 0.0000
40 E M -0.2732
41 V M 0.0000
42 V M 0.0000
43 S M 0.0000
44 A M 0.0000
45 H M 0.0000
46 R M -1.5805
47 T M 0.0000
48 P M 0.0000
49 D M -1.9674
50 K M -1.2411
51 L M 0.0000
52 F M -1.3646
53 S M -1.2545
54 F M -1.0893
55 A M 0.0000
56 E M -2.5573
57 S M -2.2889
58 A M 0.0000
59 E M -3.0217
60 E M -3.3816
61 N M -3.0141
62 G M -2.2169
63 Y M 0.0000
64 Q M -1.0746
65 V M 0.0000
66 I M 0.0000
67 I M 0.0000
68 A M 0.0000
69 G M 0.0000
70 A M 0.0000
71 G M -0.5150
72 G M -0.3622
73 A M 0.0000
74 A M 0.0000
75 H M 0.0000
76 L M 0.0000
77 P M 0.0000
78 G M 0.0000
79 M M 0.0000
80 I M 0.0000
81 A M 0.0000
82 A M 0.0000
83 K M -1.0916
84 T M 0.0000
85 L M 0.0000
86 V M 0.0000
87 P M 0.0000
88 V M 0.0000
89 L M 0.0000
90 G M 0.0000
91 V M 0.0000
92 P M 0.0000
93 V M -0.6981
94 Q M -1.3102
95 S M -0.6144
96 A M -0.4056
97 A M -0.3833
98 L M 0.0000
99 S M -0.4197
100 G M 0.0000
101 V M -0.0074
102 D M 0.0000
103 S M 0.0000
104 L M 0.0000
105 Y M 0.0000
106 S M 0.0000
107 I M 0.0000
108 V M 0.0000
109 Q M -0.3576
110 M M 0.0000
111 P M -1.1727
112 R M -2.0295
113 G M -1.0277
114 I M 0.0000
115 P M 0.0000
116 V M 0.0000
117 G M 0.0000
118 T M 0.0000
119 L M 0.0000
120 A M 0.0000
121 I M 0.0000
122 G M 0.0000
123 K M -1.6282
124 A M -1.1487
125 G M 0.0000
126 A M 0.0000
127 A M 0.0000
128 N M 0.0000
129 A M 0.0000
130 A M 0.0000
131 L M 0.0000
132 L M 0.0000
133 A M 0.0000
134 A M 0.0000
135 Q M 0.0000
136 I M 0.0000
137 L M 0.0000
138 A M 0.0000
139 T M -1.1234
140 H M -1.9521
141 D M -2.3424
142 K M -3.3998
143 E M -3.4931
144 L M 0.0000
145 H M -2.6720
146 Q M -3.2325
147 R M -2.7404
148 L M 0.0000
149 N M -2.5043
150 D M -3.0945
151 W M -1.8197
152 R M -2.2780
153 K M -3.4438
154 A M -2.5488
155 Q M -2.2768
156 T M -2.6467
157 D M -3.5741
158 E M -3.5294
159 V M 0.0000
160 L M -1.4727
161 E M -2.5668
162 N M -1.7857
163 P M -0.5657
164 Y M 0.1090 mutated: DM164Y
165 P M -0.9150
166 R M -1.9248
167 G M -1.1585
7 G N -0.8976
8 A N -0.9590
9 R N -1.2778
10 V N 0.0000
11 A N 0.0000
12 I N 0.0000
13 V N 0.0000
14 M N 0.0000
15 G N -0.4032
16 S N -0.6780
17 K N -1.1386
18 S N -0.6122
19 D N 0.0000
20 W N -0.6253
21 A N -0.3889
22 T N -0.7440
23 M N 0.0000
24 Q N -1.2229
25 F N -1.0317
26 A N 0.0000
27 A N 0.0000
28 E N -2.0531
29 I N 0.0000
30 F N 0.0000
31 E N -2.1782
32 I N -0.2128
33 L N 0.0000
34 N N -1.7861
35 V N 0.0000
36 P N -1.1333
37 H N -0.9997
38 H N -0.4182
39 V N 0.0000
40 E N -0.2755
41 V N 0.0000
42 V N 0.0000
43 S N 0.0000
44 A N 0.0000
45 H N 0.0000
46 R N -1.6312
47 T N 0.0000
48 P N -1.1357
49 D N -2.0174
50 K N -1.3059
51 L N 0.0000
52 F N -1.4310
53 S N -1.3413
54 F N 0.0000
55 A N 0.0000
56 E N -2.5907
57 S N -2.3267
58 A N 0.0000
59 E N -3.0025
60 E N -3.3911
61 N N -3.0112
62 G N -2.1786
63 Y N 0.0000
64 Q N -1.2194
65 V N 0.0000
66 I N 0.0000
67 I N 0.0000
68 A N 0.0000
69 G N 0.0000
70 A N 0.0000
71 G N -0.4672
72 G N -0.3002
73 A N 0.0000
74 A N 0.0000
75 H N 0.0000
76 L N 0.0000
77 P N 0.0000
78 G N 0.0000
79 M N 0.0000
80 I N 0.0000
81 A N 0.0000
82 A N 0.0000
83 K N -1.0637
84 T N -0.8583
85 L N 0.0000
86 V N 0.0000
87 P N 0.0000
88 V N 0.0000
89 L N 0.0000
90 G N 0.0000
91 V N 0.0000
92 P N 0.0000
93 V N -0.7204
94 Q N -1.3087
95 S N -0.5629
96 A N -0.3829
97 A N -0.3494
98 L N 0.0000
99 S N -0.3846
100 G N 0.0000
101 V N 0.0012
102 D N 0.0000
103 S N 0.0000
104 L N 0.0000
105 Y N 0.0000
106 S N 0.0000
107 I N 0.0000
108 V N 0.0000
109 Q N -0.3483
110 M N 0.0000
111 P N -1.0553
112 R N -1.7045
113 G N 0.0000
114 I N 0.0000
115 P N 0.0000
116 V N 0.0000
117 G N 0.0000
118 T N 0.0000
119 L N 0.0000
120 A N 0.0000
121 I N 0.0000
122 G N -1.1531
123 K N -2.0399
124 A N -1.4117
125 G N 0.0000
126 A N 0.0000
127 A N 0.0000
128 N N 0.0000
129 A N 0.0000
130 A N 0.0000
131 L N 0.0000
132 L N 0.0000
133 A N 0.0000
134 A N 0.0000
135 Q N 0.0000
136 I N 0.0000
137 L N 0.0000
138 A N 0.0000
139 T N -1.1014
140 H N -1.9527
141 D N -2.3457
142 K N -3.4062
143 E N -3.5053
144 L N 0.0000
145 H N -2.6309
146 Q N -3.1735
147 R N -2.6449
148 L N 0.0000
149 N N -2.2970
150 D N -2.6925
151 W N -1.6098
152 R N -2.0711
153 K N -3.0782
154 A N -2.3420
155 Q N -2.1431
156 T N -2.5142
157 D N -3.5104
158 E N -3.4857
159 V N 0.0000
160 L N -1.4920
161 E N -2.5669
162 N N -1.7692
163 P N -0.5629
164 Y N 0.1113 mutated: DN164Y
165 P N -0.9250
166 R N -1.9308
167 G N -1.1595
7 G O -0.8621
8 A O -0.8829
9 R O -1.1379
10 V O 0.0000
11 A O 0.0000
12 I O 0.0000
13 V O 0.0000
14 M O 0.0000
15 G O -0.5321
16 S O -0.9812
17 K O -1.6361
18 S O -0.8934
19 D O 0.0000
20 W O -0.7707
21 A O -0.4828
22 T O -0.7490
23 M O 0.0000
24 Q O -1.0272
25 F O -0.9738
26 A O 0.0000
27 A O 0.0000
28 E O -1.9082
29 I O 0.0000
30 F O 0.0000
31 E O -2.1172
32 I O -0.1593
33 L O 0.0000
34 N O -1.7724
35 V O 0.0000
36 P O -1.0991
37 H O -0.9072
38 H O -0.3503
39 V O 0.0000
40 E O -0.2304
41 V O 0.0000
42 V O 0.0000
43 S O 0.0000
44 A O 0.0000
45 H O 0.0000
46 R O -1.4034
47 T O 0.0000
48 P O 0.0000
49 D O -1.9714
50 K O -1.2784
51 L O 0.0000
52 F O -1.3794
53 S O -1.3261
54 F O 0.0000
55 A O 0.0000
56 E O -2.5612
57 S O -2.3023
58 A O 0.0000
59 E O -2.9011
60 E O -3.3562
61 N O -2.9785
62 G O -2.1399
63 Y O 0.0000
64 Q O -1.1849
65 V O 0.0000
66 I O 0.0000
67 I O 0.0000
68 A O 0.0000
69 G O 0.0000
70 A O 0.0000
71 G O -0.5096
72 G O -0.3493
73 A O 0.0000
74 A O 0.0000
75 H O 0.0000
76 L O 0.0000
77 P O 0.0000
78 G O 0.0000
79 M O 0.0000
80 I O 0.0000
81 A O 0.0000
82 A O 0.0000
83 K O -1.0058
84 T O 0.0000
85 L O 0.0000
86 V O 0.0000
87 P O 0.0000
88 V O 0.0000
89 L O 0.0000
90 G O 0.0000
91 V O 0.0000
92 P O 0.0000
93 V O -0.7693
94 Q O -1.3581
95 S O -0.6024
96 A O -0.4028
97 A O -0.3658
98 L O 0.0000
99 S O -0.4012
100 G O 0.0000
101 V O 0.0018
102 D O 0.0000
103 S O 0.0000
104 L O 0.0000
105 Y O 0.0000
106 S O 0.0000
107 I O 0.0000
108 V O 0.0000
109 Q O -0.3917
110 M O 0.0000
111 P O -1.2621
112 R O -2.2006
113 G O -1.1218
114 I O 0.0000
115 P O 0.0000
116 V O 0.0000
117 G O 0.0000
118 T O 0.0000
119 L O 0.0000
120 A O 0.0000
121 I O 0.0000
122 G O -1.1681
123 K O -2.0422
124 A O -1.4138
125 G O 0.0000
126 A O 0.0000
127 A O 0.0000
128 N O 0.0000
129 A O 0.0000
130 A O 0.0000
131 L O 0.0000
132 L O 0.0000
133 A O 0.0000
134 A O 0.0000
135 Q O 0.0000
136 I O 0.0000
137 L O 0.0000
138 A O 0.0000
139 T O -1.0692
140 H O -1.8897
141 D O -2.3492
142 K O -3.3992
143 E O -3.4951
144 L O 0.0000
145 H O -2.6187
146 Q O -3.1530
147 R O -2.6987
148 L O 0.0000
149 N O -2.3163
150 D O -2.7971
151 W O -1.6807
152 R O -2.1326
153 K O -3.1841
154 A O -2.3867
155 Q O -2.1595
156 T O -2.5442
157 D O -3.5144
158 E O -3.4709
159 V O 0.0000
160 L O -1.4607
161 E O -2.5358
162 N O -1.7224
163 P O -0.5365
164 Y O 0.1225 mutated: DO164Y
165 P O -0.9118
166 R O -1.9247
167 G O -1.1566

 

Laboratory of Theory of Biopolymers 2015