Project name: tev5

Status: done

submitted: 2017-03-13 07:51:13, status changed: 2017-03-13 08:00:32
Settings
Chain sequence(s) A: PRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKP
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.2863
Maximal score value
1.8526
Average score
-0.3409
Total score value
-72.9509

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
8 P A -0.4907
9 R A -1.6500
10 D A -1.9946
11 Y A -0.4052
12 N A -1.2622
13 P A -0.3332
14 I A 0.0000
15 S A 0.0000
16 S A -0.1163
17 T A 0.0000
18 I A 0.0000
19 C A 0.0000
20 H A -0.2338
21 L A 0.0000
22 T A 0.0089
23 N A 0.0000
24 E A -1.3979
25 S A 0.0000
26 D A -1.3684
27 G A -0.8878
28 H A -1.0900
29 T A -0.4503
30 T A 0.0000
31 S A -0.1066
32 L A 0.0000
33 Y A 0.0000
34 G A 0.0000
35 I A 0.0000
36 G A 0.0000
37 F A 0.0000
38 G A 0.0000
39 P A -0.1046
40 F A 0.0000
41 I A 0.0000
42 I A 0.0000
43 T A 0.0000
44 N A 0.0000
45 K A 0.0000
46 H A -0.1157
47 L A 0.0000
48 F A 0.0000
49 R A -0.6629
50 R A -1.4223
51 N A 0.0000
52 N A -1.2432
53 G A -0.3147
54 T A -0.0251
55 L A 0.0000
56 L A 0.1949
57 V A 0.0000
58 Q A -0.0975
59 S A 0.0000
60 L A 0.8614
61 H A -0.8560
62 G A -0.1516
63 V A 1.7393
64 F A 0.3793
65 K A -1.5837
66 V A 0.0000
67 K A -1.8080
68 N A -0.9006
69 T A 0.0000
70 T A -0.0460
71 T A -0.0736
72 L A 0.0000
73 Q A -0.8405
74 Q A 0.0000
75 H A 0.0000
76 L A 0.3911
77 I A 0.0000
78 D A -1.8751
79 G A -0.8417
80 R A -0.3390
81 D A 0.0000
82 M A 0.0000
83 I A 0.0000
84 I A 0.0000
85 I A 0.0000
86 R A -0.6016
87 M A 0.0000
88 P A -0.3793
89 K A -2.0419
90 D A -2.1024
91 F A 0.0000
92 P A -0.1866
93 P A -0.2888
94 F A 0.0000
95 P A -0.3858
96 Q A -1.5443
97 K A -1.9225
98 L A 0.0000
99 K A -1.3170
100 F A 0.0000
101 R A -0.2870
102 E A -0.5435
103 P A 0.0000
104 Q A -0.9395
105 R A -2.2863
106 E A -2.1555
107 E A 0.0000
108 R A -1.0758
109 I A 0.0000
110 C A 0.0000
111 L A 0.0000
112 V A 0.0000
113 T A 0.0000
114 T A 0.0000
115 N A -0.8482
116 F A -0.0454
117 Q A -1.1616
118 T A -0.5999
119 K A -1.7521
120 S A -0.4231
121 M A 0.5038
122 S A -0.1270
123 S A 0.0284
124 M A 0.9083
125 V A 0.7895
126 S A -0.2555
127 D A -1.8056
128 T A -0.3846
129 S A 0.0593
130 C A 0.5938
131 T A 0.0000
132 F A 1.5851
133 P A 0.2417
134 S A 0.0000
135 S A -0.5369
136 D A -1.8377
137 G A -0.3548
138 I A 0.1900
139 F A 0.0000
140 W A 0.0000
141 K A -0.3082
142 H A 0.0000
143 W A 0.6221
144 I A 0.0000
145 Q A -1.1997
146 T A -0.5425
147 K A -2.0322
148 D A -2.1633
149 G A -0.6971
150 Q A -0.2958
151 A A -0.0399
152 G A 0.0000
153 S A 0.0000
154 P A 0.0000
155 L A 0.0000
156 V A 0.0000
157 S A 0.0000
158 T A -0.3539
159 R A -1.9341
160 D A -0.8296
161 G A -0.0777
162 F A 0.4763
163 I A 0.0000
164 V A 0.0000
165 G A 0.0000
166 I A 0.0000
167 H A 0.0000
168 S A -0.0183
169 A A -0.0045
170 S A -0.1348
171 N A -0.0617
172 F A 1.8526
173 T A 0.0519
174 N A -1.2989
175 T A -0.3613
176 N A -0.3217
177 N A 0.0000
178 Y A 0.0929
179 F A 0.0000
180 T A 0.0000
181 S A 0.0000
182 V A 0.0000
183 P A -0.3405
184 K A -1.9366
185 N A -1.5824
186 F A 0.0000
187 M A -0.0158
188 E A -1.7321
189 L A -0.1825
190 L A 0.0000
191 T A -0.1465
192 N A -0.6494
193 Q A -1.6245
194 E A -2.0363
195 A A -0.3323
196 Q A -0.4663
197 Q A -1.1653
198 W A 0.1917
199 V A 0.6187
200 S A -0.1669
201 G A -0.1123
202 W A 0.0948
203 R A -0.8382
204 L A -0.2607
205 N A -1.2282
206 A A -0.5180
207 D A -1.7885
208 S A -0.2273
209 V A 0.4500
210 L A 1.3847
211 W A 0.4280
212 G A -0.0944
213 G A -0.5261
214 H A -0.6671
215 K A -1.4974
216 V A 0.1055
217 F A 0.8981
218 M A 0.2488
219 S A -0.5023
220 K A -1.7857
221 P A -0.5640

 

Laboratory of Theory of Biopolymers 2015