Project name: c9a12705dde0234

Status: done

submitted: 2017-11-14 10:16:07, status changed: 2017-11-14 11:42:07
Settings
Chain sequence(s) A: ELQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: ELQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCMKIDAIVGRNSAKDIRTEERWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCMKIDAIVGRNSAKDIRTEERWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9515
Maximal score value
2.0982
Average score
-0.8396
Total score value
-1126.7709

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.5179
2 L A -0.2240
3 Q A 0.0000
4 M A -0.9001
5 T A 0.0000
6 Q A -1.7494
7 S A -1.0327
8 P A -1.1928
9 S A -0.9902
10 S A -0.8979
11 L A -0.5508
12 S A -0.8234
13 A A -0.9963
14 S A -0.9045
15 V A 0.2039
16 G A -0.7597
17 D A -1.9165
18 R A -2.3980
19 V A 0.0000
20 T A -0.7842
21 I A 0.0000
22 T A -1.3473
23 C A 0.0000
24 R A -2.7999
25 T A 0.0000
26 S A -1.4233
27 Q A -1.9057
28 S A -1.3824
29 I A 0.0000
30 S A -0.2281
31 S A 0.2074
32 Y A 0.9133
33 L A 0.0000
34 N A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.1305
39 K A -1.7604
40 P A -1.4526
41 G A -1.1881
42 Q A -1.4504
43 P A -1.2426
44 P A 0.0000
45 K A -0.9082
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.2736
50 W A 0.8748
51 A A 0.2312
52 S A -0.0601
53 T A -0.2219
54 R A -0.9472
55 E A 0.0000
56 S A -0.5567
57 G A -0.8531
58 V A -0.8075
59 P A -1.4359
60 D A -2.1560
61 R A -1.5331
62 F A 0.0000
63 S A -0.7953
64 G A -0.2507
65 S A -0.5803
66 G A -1.1665
67 S A -1.0695
68 G A -1.4476
69 T A -2.1515
70 D A -2.9085
71 F A 0.0000
72 T A -1.0620
73 L A 0.0000
74 T A -0.5891
75 I A 0.0000
76 S A -1.5643
77 S A -1.1149
78 L A 0.0000
79 Q A -0.8330
80 P A -1.4733
81 E A -2.2507
82 D A 0.0000
83 S A -1.3841
84 A A 0.0000
85 T A -1.0176
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 S A 0.3597
92 Y A 0.3210
93 D A -1.0242
94 I A 0.1396
95 P A -0.1513
96 Y A -0.1838
97 T A -0.4106
98 F A 0.0000
99 G A 0.0000
100 Q A -1.7877
101 G A -1.4577
102 T A 0.0000
103 K A -1.4949
104 L A 0.0000
105 E A -1.3300
106 I A -1.1567
107 K A -1.6896
108 R A -1.8857
109 T A -0.4108
110 V A 0.8597
111 A A 0.2811
112 A A 0.0964
113 P A -0.3484
114 S A -0.3331
115 V A 0.0000
116 F A 0.0997
117 I A 0.0000
118 F A 0.0000
119 P A -0.3755
120 P A 0.0000
121 S A -1.9082
122 D A -3.2882
123 E A -3.3001
124 Q A 0.0000
125 L A 0.0000
126 K A -3.0564
127 S A -1.8219
128 G A -1.1823
129 T A -0.7913
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -0.9584
139 F A 0.0000
140 Y A 0.0000
141 P A -1.8849
142 R A -3.2405
143 E A -3.3180
144 A A -2.5395
145 K A -2.5841
146 V A -1.4023
147 Q A -1.1636
148 W A 0.0000
149 K A -0.5224
150 V A -0.7474
151 D A -1.3695
152 N A -1.2433
153 A A -0.2834
154 L A 0.5077
155 Q A -0.7727
156 S A -0.7022
157 G A -1.2239
158 N A -2.0148
159 S A -1.6286
160 Q A -1.4226
161 E A -1.9009
162 S A 0.0000
163 V A -0.8776
164 T A -1.1527
165 E A -2.3383
166 Q A -2.2208
167 D A -2.1189
168 S A -2.1134
169 K A -2.2938
170 D A -1.9924
171 S A -2.2132
172 T A -1.7430
173 Y A 0.0000
174 S A 0.0000
175 L A -0.7781
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.4956
181 L A -0.6086
182 S A -0.9877
183 K A -1.5315
184 A A -1.6041
185 D A -2.3553
186 Y A 0.0000
187 E A -2.4043
188 K A -3.0572
189 H A -2.3793
190 K A -2.2754
191 V A -0.9606
192 Y A 0.0000
193 A A -0.7350
194 C A 0.0000
195 E A -1.1253
196 V A 0.0000
197 T A -1.2384
198 H A 0.0000
199 Q A -1.7534
200 G A -0.3419
201 L A 0.0257
202 S A -0.3597
203 S A -0.3176
204 P A -0.5475
205 V A 0.0078
206 T A -0.4540
207 K A -0.5841
208 S A -0.4714
209 F A 0.0000
210 N A -1.2896
211 R A -1.8436
212 G A -1.8339
213 E A -2.3692
214 C A -1.9102
215 E B -2.5780
216 V B -1.8712
217 Q B -1.3550
218 L B 0.0000
219 L B 0.0197
220 E B -0.3027
221 S B -0.7297
222 G B -0.9469
223 G B -0.6661
224 G B -0.1001
225 V B 0.2337
226 V B -0.6804
227 Q B -2.0112
228 P B -2.2194
229 G B -2.3577
230 R B -2.8285
231 S B -2.0926
232 L B -1.5272
233 R B -2.1657
234 L B 0.0000
235 S B -0.7240
236 C B 0.0000
237 A B -0.3316
238 A B 0.0000
239 S B -0.8851
240 G B -1.2980
241 F B -0.3570
242 T B -0.0599
243 F B 0.0000
244 S B -0.7188
245 S B -0.0912
246 Y B 0.1208
247 G B 0.0000
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -1.0527
254 A B -1.3072
255 P B -1.0666
256 G B -1.5004
257 K B -2.5280
258 G B -1.8922
259 L B 0.0000
260 E B -1.6230
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.0000
265 I B 0.0000
266 S B -0.7174
267 Y B -0.2592
268 D B -1.8032
269 G B -1.6185
270 S B -1.4747
271 N B -1.8249
272 K B -1.2454
273 Y B 0.4393
274 Y B 0.2002
275 A B -0.8596
276 D B -2.4314
277 S B -2.0229
278 V B 0.0000
279 K B -2.5848
280 G B -2.0590
281 R B -2.6343
282 F B 0.0000
283 T B -1.1984
284 I B 0.0000
285 S B -0.7682
286 R B -1.0292
287 D B -1.7016
288 N B -1.6107
289 S B -1.5490
290 K B -2.3626
291 N B -1.7215
292 T B 0.0000
293 L B 0.0000
294 Y B -0.6146
295 L B 0.0000
296 Q B -1.6034
297 M B 0.0000
298 N B -2.2050
299 S B -2.0286
300 L B 0.0000
301 R B -3.2494
302 A B -2.0717
303 E B -2.4868
304 D B 0.0000
305 T B -0.7920
306 A B 0.0000
307 V B 0.0717
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 M B 0.0000
312 K B 0.0000
313 I B -0.2712
314 D B -1.7949
315 A B -0.7162
316 I B 0.0000
317 V B 0.0000
318 G B 0.0000
319 R B -1.2661
320 N B -1.4871
321 S B -1.6473
322 A B -1.6139
323 K B -2.6912
324 D B -2.1897
325 I B -0.2330
326 R B -1.7494
327 T B -1.3088
328 E B 0.0000
329 E B 0.0000
330 R B -1.0225
331 W B 0.0000
332 G B 0.0000
333 Q B -1.2260
334 G B -0.6002
335 T B -0.3646
336 T B -0.2395
337 V B 0.0000
338 T B -0.2717
339 V B 0.0000
340 S B -0.8730
341 S B -0.6687
342 A B -0.6096
343 S B -0.9236
344 T B -1.2662
345 K B -2.3434
346 G B -2.0934
347 P B -1.1555
348 S B -0.8382
349 V B 0.0000
350 F B 0.0000
351 P B -1.4816
352 L B 0.0000
353 A B -0.9578
354 P B -0.7984
355 S B -1.1774
356 S B -1.5585
357 K B -2.3032
358 S B -1.5973
359 T B -1.0003
360 S B -1.0693
361 G B -0.9203
362 G B -0.9502
363 T B -0.6537
364 A B 0.0000
365 A B 0.0000
366 L B 0.0000
367 G B 0.0000
368 C B 0.0000
369 L B 0.0000
370 V B 0.0000
371 K B -0.5942
372 D B -1.4389
373 Y B 0.0000
374 F B 0.0000
375 P B 0.0000
376 E B -1.1848
377 P B -1.0706
378 V B -0.8891
379 T B -0.5453
380 V B -0.2857
381 S B -0.3142
382 W B 0.0000
383 N B -0.7824
384 S B -0.6355
385 G B -0.3637
386 A B -0.1379
387 L B 0.1193
388 T B -0.0774
389 S B -0.1066
390 G B -0.1235
391 V B 0.3152
392 H B -0.1372
393 T B 0.0715
394 F B 0.0000
395 P B -0.1938
396 A B 0.3760
397 V B 0.6506
398 L B 1.0577
399 Q B -0.5841
400 S B -0.4542
401 S B -0.5491
402 G B 0.0000
403 L B -0.3692
404 Y B -0.0921
405 S B 0.0000
406 L B 0.0756
407 S B 0.0000
408 S B 0.0000
409 V B 0.0000
410 V B 0.0000
411 T B -0.1119
412 V B 0.0000
413 P B -0.6432
414 S B -0.6771
415 S B -0.7089
416 S B -0.7649
417 L B -0.8906
418 G B -1.1592
419 T B -0.9137
420 Q B -1.3746
421 T B -1.3139
422 Y B 0.0000
423 I B -1.4967
424 C B 0.0000
425 N B -1.6531
426 V B 0.0000
427 N B -1.9015
428 H B 0.0000
429 K B -2.7477
430 P B -1.7992
431 S B -2.0061
432 N B -2.4841
433 T B -2.1175
434 K B -2.5814
435 V B -1.8779
436 D B -2.7834
437 K B -2.5237
438 K B -2.9120
439 V B 0.0000
440 E B -2.9343
441 P B -2.2116
442 K B -2.7731
443 S B -1.9409
444 C B -1.9278
445 D B -2.4118
446 K B -2.5376
447 T B -1.7288
448 H B -2.1737
449 T B -1.6428
450 C B 0.0000
451 P B -1.1421
452 P B -0.7212
453 C B -0.0916
454 P B -0.5343
455 A B -0.7569
456 P B -0.9515
457 E B -1.1114
458 L B 0.6073
459 L B 1.3145
460 G B 0.2657
461 G B -0.1810
462 P B -0.4089
463 S B -0.0106
464 V B 0.0000
465 F B 1.1223
466 L B 0.0000
467 F B 1.4821
468 P B 0.1246
469 P B 0.0000
470 K B -2.0760
471 P B -1.4484
472 K B -1.3285
473 D B -1.5017
474 T B 0.0000
475 L B 0.0000
476 M B 0.4219
477 I B 1.3652
478 S B -0.0888
479 R B -1.3837
480 T B -0.5601
481 P B 0.0000
482 E B -0.8334
483 V B 0.0000
484 T B 0.7487
485 C B 0.0000
486 V B 0.3529
487 V B 0.0000
488 V B -0.2541
489 D B -0.7806
490 V B 0.0000
491 S B -1.9037
492 H B -2.3108
493 E B -2.9167
494 D B -2.5559
495 P B -2.7504
496 E B -3.4146
497 V B 0.0000
498 K B -2.6625
499 F B 0.0000
500 N B -1.3156
501 W B 0.0000
502 Y B -1.0832
503 V B -0.7691
504 D B -1.8446
505 G B -0.6828
506 V B 0.8213
507 E B -0.5103
508 V B 0.6297
509 H B -0.9676
510 N B -1.0222
511 A B -1.0994
512 K B -2.2164
513 T B -1.6482
514 K B -2.8806
515 P B -2.2766
516 R B -3.6428
517 E B -3.9515
518 E B -3.2393
519 Q B -2.6080
520 Y B -1.3945
521 N B -1.4452
522 S B -1.2679
523 T B -1.5624
524 Y B -2.3677
525 R B -2.1777
526 V B 0.0000
527 V B -1.0205
528 S B 0.0000
529 V B 0.0055
530 L B 0.0000
531 T B -0.2386
532 V B 0.4947
533 L B 1.0704
534 H B -0.0690
535 Q B -0.9930
536 D B -0.9863
537 W B 0.0000
538 L B -0.9034
539 N B -1.9533
540 G B -1.9236
541 K B -2.0363
542 E B -2.3374
543 Y B 0.0000
544 K B -1.9408
545 C B 0.0000
546 K B -1.7192
547 V B 0.0000
548 S B -1.4774
549 N B -1.9104
550 K B -2.1010
551 A B -1.2705
552 L B -0.5817
553 P B -0.4193
554 A B -0.3161
555 P B -0.4615
556 I B -0.3474
557 E B -1.3995
558 K B -1.2867
559 T B -1.1662
560 I B -0.1075
561 S B -1.4965
562 K B -1.3774
563 A B -1.2565
564 K B -2.3109
565 G B -2.0835
566 Q B -2.1358
567 P B -2.2508
568 R B -2.7545
569 E B -2.8261
570 P B 0.0000
571 Q B -1.3572
572 V B 0.0000
573 Y B 0.0000
574 T B -0.8068
575 L B 0.0000
576 P B -0.5696
577 P B 0.0000
578 S B -1.0604
579 R B -2.0539
580 D B -1.8194
581 E B 0.0000
582 L B -0.8086
583 T B -1.2575
584 K B -2.4389
585 N B -2.6499
586 Q B -2.3987
587 V B 0.0000
588 S B 0.0000
589 L B 0.0000
590 T B 0.0000
591 C B 0.0000
592 L B 0.0000
593 V B 0.0000
594 K B 0.0000
595 G B -1.0716
596 F B 0.0000
597 Y B -1.3899
598 P B 0.0000
599 S B -0.0936
600 D B -1.0782
601 I B 0.0000
602 A B -0.5266
603 V B -0.4012
604 E B -1.2026
605 W B 0.0000
606 E B -1.8510
607 S B 0.0000
608 N B -1.9903
609 G B -1.7557
610 Q B -2.1823
611 P B -2.0136
612 E B -2.2828
613 N B -2.0417
614 N B -1.4759
615 Y B -0.9003
616 K B -0.4913
617 T B -0.2959
618 T B 0.0000
619 P B 0.0230
620 P B 0.2166
621 V B 0.6764
622 L B 0.7801
623 D B -0.4502
624 S B -1.3439
625 D B -1.9657
626 G B -0.8317
627 S B 0.0000
628 F B 0.1305
629 F B 0.0000
630 L B 0.0000
631 Y B 0.0000
632 S B 0.0000
633 K B 0.0000
634 L B 0.0000
635 T B -0.8503
636 V B 0.0000
637 D B -2.4529
638 K B -2.2690
639 S B -2.0260
640 R B -2.3603
641 W B 0.0000
642 Q B -2.7076
643 Q B -2.5491
644 G B -1.7154
645 N B -1.3126
646 V B -0.5025
647 F B 0.0000
648 S B -1.1775
649 C B 0.0000
650 S B 0.0000
651 V B 0.0000
652 M B -0.7446
653 H B 0.0000
654 E B -1.4081
655 A B -1.9509
656 L B 0.0000
657 H B -1.8740
658 N B -1.7731
659 H B -1.3273
660 Y B -0.7779
661 T B -1.1921
662 Q B -1.4972
663 K B -1.3044
664 S B -0.4754
665 L B 0.0000
666 S B 0.0000
667 L B 0.9735
668 S B 0.0913
669 P B -0.5558
670 G B -0.6876
671 K B -1.7389
672 E C -1.4042
673 L C 0.0473
674 Q C 0.0000
675 M C -0.8163
676 T C 0.0000
677 Q C -1.5291
678 S C -0.8192
679 P C -1.0002
680 S C -0.9484
681 S C -0.8197
682 L C -0.4126
683 S C -0.8969
684 A C 0.0000
685 S C -1.1742
686 V C -0.5168
687 G C -1.0944
688 D C -1.9027
689 R C -2.4321
690 V C 0.0000
691 T C -0.6823
692 I C 0.0000
693 T C -1.0830
694 C C 0.0000
695 R C -2.4816
696 T C 0.0000
697 S C -1.2862
698 Q C -1.7860
699 S C -1.2510
700 I C 0.0000
701 S C 0.0158
702 S C 0.5277
703 Y C 1.2717
704 L C 0.0000
705 N C 0.0000
706 W C 0.0000
707 Y C 0.0000
708 Q C -0.7948
709 Q C -1.2304
710 K C -1.6309
711 P C -1.2908
712 G C -1.1878
713 Q C -1.2884
714 P C -1.3612
715 P C 0.0000
716 K C -1.3195
717 L C 0.0000
718 L C 0.0000
719 I C 0.0000
720 Y C 0.5815
721 W C 1.2800
722 A C 0.4305
723 S C -0.0411
724 T C -0.3628
725 R C -1.3981
726 E C 0.0000
727 S C -1.0534
728 G C -0.8835
729 V C -0.8965
730 P C -1.4632
731 D C -2.1943
732 R C -1.4633
733 F C 0.0000
734 S C -0.8565
735 G C -0.2654
736 S C -0.4244
737 G C -0.8471
738 S C -0.7803
739 G C -1.2003
740 T C -1.8356
741 D C -2.3946
742 F C 0.0000
743 T C -0.8577
744 L C 0.0000
745 T C -0.5643
746 I C 0.0000
747 S C -1.6019
748 S C -1.2828
749 L C 0.0000
750 Q C -1.0817
751 P C -1.6030
752 E C -2.2018
753 D C 0.0000
754 S C -1.4238
755 A C 0.0000
756 T C -1.0252
757 Y C 0.0000
758 Y C 0.0000
759 C C 0.0000
760 Q C 0.0000
761 Q C 0.0000
762 S C 0.5145
763 Y C 0.3246
764 D C -1.0800
765 I C -0.0792
766 P C -0.4323
767 Y C -0.2811
768 T C -0.4255
769 F C 0.0000
770 G C 0.0000
771 Q C -1.7963
772 G C -1.4175
773 T C 0.0000
774 K C -1.4865
775 L C 0.0000
776 E C -1.3180
777 I C 0.0000
778 K C -1.5448
779 R C -1.7703
780 T C -0.1965
781 V C 0.9673
782 A C 0.3204
783 A C 0.0684
784 P C -0.1630
785 S C -0.3116
786 V C 0.0000
787 F C 0.1584
788 I C 0.0000
789 F C 0.0000
790 P C 0.0000
791 P C 0.0000
792 S C 0.0000
793 D C -3.0662
794 E C -3.1484
795 Q C 0.0000
796 L C -2.2313
797 K C -2.8099
798 S C -1.7780
799 G C -1.2709
800 T C -0.8620
801 A C 0.0000
802 S C 0.0000
803 V C 0.0000
804 V C 0.0000
805 C C 0.0000
806 L C 0.0000
807 L C 0.0000
808 N C 0.0000
809 N C -1.2301
810 F C 0.0000
811 Y C 0.0000
812 P C -1.8019
813 R C -3.2265
814 E C -3.3228
815 A C -2.5426
816 K C -2.6843
817 V C -1.3234
818 Q C -1.1916
819 W C 0.0000
820 K C -0.6539
821 V C -0.9064
822 D C -1.5376
823 N C -1.3055
824 A C -0.3611
825 L C 0.3549
826 Q C -1.0457
827 S C -0.8172
828 G C -1.2569
829 N C -1.9438
830 S C -1.5218
831 Q C -1.2125
832 E C -1.7139
833 S C 0.0000
834 V C -0.6083
835 T C -1.1235
836 E C -2.3778
837 Q C -2.5380
838 D C -2.8285
839 S C -2.6751
840 K C -3.0002
841 D C -3.3419
842 S C 0.0000
843 T C -2.1831
844 Y C 0.0000
845 S C 0.0000
846 L C 0.0000
847 S C 0.0000
848 S C 0.0000
849 T C -0.6430
850 L C 0.0000
851 T C -0.5167
852 L C -0.6841
853 S C -1.3603
854 K C -2.1519
855 A C -2.3427
856 D C -3.2857
857 Y C 0.0000
858 E C -3.8628
859 K C -3.8084
860 H C -3.1252
861 K C -3.2209
862 V C -1.3366
863 Y C 0.0000
864 A C -0.9888
865 C C 0.0000
866 E C -1.1326
867 V C 0.0000
868 T C -1.1688
869 H C 0.0000
870 Q C -1.7785
871 G C -0.4084
872 L C -0.1060
873 S C -0.4196
874 S C -0.3263
875 P C -0.4709
876 V C -0.0199
877 T C -0.6044
878 K C -0.9829
879 S C -0.7978
880 F C 0.0000
881 N C -1.8729
882 R C -2.0679
883 G C -1.7974
884 E C -2.0492
885 C C -1.3463
886 E D -2.1962
887 V D -1.4263
888 Q D -1.1432
889 L D 0.0000
890 L D 0.6923
891 E D 0.0000
892 S D -0.4916
893 G D -0.9091
894 G D -0.6843
895 G D -0.1632
896 V D 0.2284
897 V D -0.6501
898 Q D -1.8841
899 P D -2.1272
900 G D -2.2803
901 R D -2.7837
902 S D -1.9220
903 L D -1.5081
904 R D -2.0618
905 L D 0.0000
906 S D -0.5601
907 C D 0.0000
908 A D -0.0143
909 A D 0.0000
910 S D -0.6664
911 G D -1.0370
912 F D -0.2200
913 T D -0.0606
914 F D 0.0000
915 S D -0.6701
916 S D -0.0550
917 Y D 0.4534
918 G D 0.3814
919 M D 0.0000
920 H D 0.0000
921 W D 0.0000
922 V D 0.0000
923 R D 0.0000
924 Q D -1.1464
925 A D -1.3553
926 P D -1.0790
927 G D -1.4740
928 K D -2.5324
929 G D -1.8896
930 L D -1.3783
931 E D -1.9166
932 W D 0.0000
933 V D 0.0000
934 A D 0.0000
935 V D 0.0000
936 I D 0.0000
937 S D -0.5558
938 Y D 0.1264
939 D D -1.6404
940 G D -1.5429
941 S D -1.3903
942 N D -1.8517
943 K D -1.6475
944 Y D -0.1821
945 Y D -0.7224
946 A D -1.2952
947 D D -2.5447
948 S D -2.0530
949 V D 0.0000
950 K D -2.5412
951 G D -1.7684
952 R D -1.7912
953 F D 0.0000
954 T D -1.0992
955 I D 0.0000
956 S D -0.8904
957 R D -1.2520
958 D D -1.8198
959 N D -1.7658
960 S D -1.6191
961 K D -2.4169
962 N D -1.7845
963 T D -1.0090
964 L D 0.0000
965 Y D -0.5745
966 L D 0.0000
967 Q D -1.2048
968 M D 0.0000
969 N D -1.9054
970 S D -1.7742
971 L D 0.0000
972 R D -3.1479
973 A D -2.0286
974 E D -2.5006
975 D D 0.0000
976 T D -0.8128
977 A D 0.0000
978 V D -0.0931
979 Y D 0.0000
980 Y D 0.0000
981 C D 0.0000
982 M D 0.0000
983 K D 0.0000
984 I D 0.8010
985 D D -0.1551
986 A D 0.3191
987 I D 0.0000
988 V D 0.0000
989 G D 0.0000
990 R D -2.2019
991 N D -1.6833
992 S D -1.6804
993 A D -2.1035
994 K D -2.9610
995 D D -2.9533
996 I D -2.1537
997 R D -2.3291
998 T D -1.1041
999 E D 0.0000
1000 E D 0.0000
1001 R D 0.0000
1002 W D 0.0000
1003 G D 0.0000
1004 Q D -1.2142
1005 G D -0.4724
1006 T D -0.3194
1007 T D -0.2796
1008 V D 0.0000
1009 T D -0.2444
1010 V D 0.0000
1011 S D -0.8260
1012 S D -0.6684
1013 A D -0.7126
1014 S D -0.9298
1015 T D -1.2700
1016 K D -2.3359
1017 G D -2.0080
1018 P D -1.1916
1019 S D -0.6123
1020 V D 0.0000
1021 F D -0.8001
1022 P D -1.3586
1023 L D 0.0000
1024 A D 0.0000
1025 P D -0.6053
1026 S D 0.0000
1027 S D -1.2838
1028 K D -1.9732
1029 S D -1.2076
1030 T D -0.9807
1031 S D -0.8728
1032 G D -0.7589
1033 G D -0.6787
1034 T D -0.5169
1035 A D 0.0000
1036 A D 0.0000
1037 L D 0.0000
1038 G D 0.0000
1039 C D 0.0000
1040 L D 0.0000
1041 V D 0.0000
1042 K D -0.7291
1043 D D -1.6451
1044 Y D 0.0000
1045 F D 0.0000
1046 P D 0.0000
1047 E D -0.8793
1048 P D -0.8888
1049 V D -0.7482
1050 T D -0.6584
1051 V D -0.0335
1052 S D -0.3418
1053 W D 0.0000
1054 N D -0.8105
1055 S D -0.6400
1056 G D -0.3289
1057 A D -0.1367
1058 L D 0.1213
1059 T D -0.0514
1060 S D -0.0826
1061 G D -0.2395
1062 V D 0.3291
1063 H D -0.1920
1064 T D 0.0404
1065 F D 0.0000
1066 P D -0.2671
1067 A D 0.0659
1068 V D 0.3641
1069 L D 0.3588
1070 Q D -0.7094
1071 S D -0.6041
1072 S D -0.6433
1073 G D -1.1351
1074 L D -0.7995
1075 Y D -0.4878
1076 S D 0.0000
1077 L D 0.0000
1078 S D 0.0000
1079 S D 0.0000
1080 V D 0.0000
1081 V D 0.0000
1082 T D -0.0594
1083 V D 0.0000
1084 P D -0.5880
1085 S D -0.6244
1086 S D -0.7037
1087 S D -0.8508
1088 L D 0.0000
1089 G D -1.2620
1090 T D -0.9760
1091 Q D -1.4421
1092 T D -1.3785
1093 Y D 0.0000
1094 I D -1.3177
1095 C D 0.0000
1096 N D -1.6232
1097 V D 0.0000
1098 N D -2.2439
1099 H D 0.0000
1100 K D -2.8155
1101 P D -1.8145
1102 S D -2.0404
1103 N D -2.6268
1104 T D -2.2394
1105 K D -2.7633
1106 V D -1.8533
1107 D D -2.6746
1108 K D -2.1919
1109 K D -2.7488
1110 V D 0.0000
1111 E D -2.6255
1112 P D -1.5805
1113 K D -1.3325
1114 S D -1.2927
1115 C D -1.0620
1116 D D -1.9466
1117 K D -2.6695
1118 T D -1.9090
1119 H D -1.7897
1120 T D -1.1302
1121 C D -1.0662
1122 P D -0.6301
1123 P D -0.4414
1124 C D -0.3087
1125 P D -0.7245
1126 A D 0.0000
1127 P D -0.8589
1128 E D -1.5330
1129 L D -0.0711
1130 L D 1.1798
1131 G D -0.0037
1132 G D -0.0811
1133 P D -0.1841
1134 S D 0.2575
1135 V D 0.7915
1136 F D 2.0982
1137 L D 0.0000
1138 F D 2.0324
1139 P D 0.4506
1140 P D 0.0000
1141 K D -1.8641
1142 P D -1.2028
1143 K D -0.9088
1144 D D 0.0000
1145 T D 0.0000
1146 L D 0.0000
1147 M D 0.8952
1148 I D 1.5660
1149 S D 0.0209
1150 R D -1.1760
1151 T D -0.6016
1152 P D 0.0000
1153 E D -0.9003
1154 V D 0.0000
1155 T D 0.9689
1156 C D 0.0000
1157 V D 0.8476
1158 V D 0.0000
1159 V D 0.2116
1160 D D -0.2640
1161 V D 0.0000
1162 S D -1.8073
1163 H D -2.3339
1164 E D -2.8935
1165 D D -2.3326
1166 P D -2.5224
1167 E D -3.0029
1168 V D 0.0000
1169 K D -2.5852
1170 F D 0.0000
1171 N D -1.6134
1172 W D 0.0000
1173 Y D -1.1978
1174 V D 0.0000
1175 D D -2.1249
1176 G D -0.7452
1177 V D 0.8499
1178 E D -0.2903
1179 V D 0.2045
1180 H D -1.2061
1181 N D -1.0759
1182 A D -1.0843
1183 K D -1.9569
1184 T D -1.2216
1185 K D -1.7783
1186 P D -1.7953
1187 R D -2.5985
1188 E D -2.4732
1189 E D -2.3257
1190 Q D -1.8169
1191 Y D -0.5157
1192 N D -0.8431
1193 S D -0.8627
1194 T D -1.0126
1195 Y D -1.4792
1196 R D -1.6191
1197 V D 0.0000
1198 V D -0.5835
1199 S D 0.0000
1200 V D 0.0828
1201 L D 0.0000
1202 T D -0.3253
1203 V D 0.4581
1204 L D 1.1212
1205 H D 0.0665
1206 Q D -0.8779
1207 D D -0.9779
1208 W D 0.0000
1209 L D -1.1008
1210 N D -1.9925
1211 G D -2.1350
1212 K D -2.2895
1213 E D -2.5999
1214 Y D 0.0000
1215 K D -2.2419
1216 C D 0.0000
1217 K D -2.0209
1218 V D 0.0000
1219 S D -1.4905
1220 N D -1.8854
1221 K D -2.0888
1222 A D -1.2976
1223 L D -0.5612
1224 P D -0.4593
1225 A D -0.3291
1226 P D -0.5074
1227 I D -0.6541
1228 E D -2.1287
1229 K D -1.9381
1230 T D -1.5619
1231 I D -0.3093
1232 S D -1.8438
1233 K D -1.7321
1234 A D -1.4861
1235 K D -2.3983
1236 G D -2.1753
1237 Q D -2.2561
1238 P D -2.4316
1239 R D -3.2175
1240 E D -3.0523
1241 P D 0.0000
1242 Q D -1.6889
1243 V D 0.0000
1244 Y D 0.0000
1245 T D 0.0000
1246 L D 0.0000
1247 P D -0.4581
1248 P D -0.7487
1249 S D -1.3609
1250 R D -2.5475
1251 D D -2.6372
1252 E D 0.0000
1253 L D -1.0091
1254 T D -1.2130
1255 K D -2.1516
1256 N D -2.6649
1257 Q D -2.6821
1258 V D 0.0000
1259 S D 0.0000
1260 L D 0.0000
1261 T D 0.0000
1262 C D 0.0000
1263 L D 0.0000
1264 V D 0.0000
1265 K D -0.8015
1266 G D -1.3369
1267 F D 0.0000
1268 Y D -1.5411
1269 P D 0.0000
1270 S D -0.0281
1271 D D -0.9997
1272 I D 0.0000
1273 A D -0.4701
1274 V D 0.0000
1275 E D -1.0925
1276 W D 0.0000
1277 E D -1.9908
1278 S D 0.0000
1279 N D -2.0026
1280 G D -1.8465
1281 Q D -2.2161
1282 P D -1.9273
1283 E D -2.0873
1284 N D -2.0315
1285 N D -1.6886
1286 Y D -1.0247
1287 K D -0.7141
1288 T D -0.3890
1289 T D 0.0000
1290 P D 0.0391
1291 P D 0.3132
1292 V D 0.8902
1293 L D 1.1065
1294 D D -0.2427
1295 S D -1.1873
1296 D D -1.9647
1297 G D -0.9224
1298 S D -0.8290
1299 F D 0.1536
1300 F D 0.0000
1301 L D 0.0000
1302 Y D 0.0000
1303 S D 0.0000
1304 K D 0.0000
1305 L D 0.0000
1306 T D -1.0671
1307 V D 0.0000
1308 D D -2.8689
1309 K D -2.6036
1310 S D -2.1929
1311 R D -2.3022
1312 W D -1.8507
1313 Q D -2.3114
1314 Q D -2.2016
1315 G D -1.1955
1316 N D -1.1413
1317 V D -0.3209
1318 F D 0.0000
1319 S D -1.2383
1320 C D 0.0000
1321 S D -0.8313
1322 V D 0.0000
1323 M D 0.0000
1324 H D 0.0000
1325 E D -1.1938
1326 A D -1.9762
1327 L D 0.0000
1328 H D -1.6652
1329 N D -1.5533
1330 H D -0.6761
1331 Y D -0.1180
1332 T D -0.9428
1333 Q D -1.4023
1334 K D -1.3416
1335 S D -0.6044
1336 L D 0.0000
1337 S D 0.0183
1338 L D 0.6815
1339 S D 0.2559
1340 P D -0.1847
1341 G D -0.2480
1342 K D -0.6253

 

Laboratory of Theory of Biopolymers 2015