Project name: 1a6w_full_stat

Status: done

submitted: 2017-09-14 09:35:58, status changed: 2017-09-14 09:44:36
Settings
Chain sequence(s) H: QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSS
L: AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGGNNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLE
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5467
Maximal score value
1.5072
Average score
-0.5481
Total score value
-125.5149

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 A L 0.8838
3 V L 1.4399
4 V L 0.0000
5 T L -0.6161
6 Q L -1.2437
7 E L -1.2039
8 S L -0.8707
9 A L -0.6671
10 L L -0.2461
11 T L 0.0128
12 T L 0.0000
13 S L -0.6527
14 P L -1.3306
15 G L -1.4222
16 E L -1.7553
17 T L -0.9321
18 V L 0.0000
19 T L 0.0917
20 L L 0.0000
21 T L -0.5723
22 C L 0.0000
23 R L -1.9871
24 S L -0.8123
25 S L -0.0918
26 T L -0.1959
27 G L -0.8498
28 A L -0.9662
29 V L 0.0000
30 T L -0.2383
31 T L -0.1277
32 S L -0.1044
33 N L 0.1384
34 Y L 0.3198
35 A L 0.0000
36 N L 0.0000
37 W L 0.0000
38 V L 0.0000
39 Q L 0.0000
40 E L 0.0000
41 K L -1.0503
42 P L -1.2792
43 D L -2.0730
44 H L -1.2913
45 L L -0.1503
46 F L 0.0000
47 T L 0.2821
48 G L 0.0000
49 L L 0.0000
50 I L 0.0000
51 G L 0.0000
52 G L -0.4171
53 T L 0.0000
54 N L -1.6924
55 N L -1.5769
56 R L -1.6114
57 A L 0.0000
58 P L -0.7067
59 G L -0.6478
60 V L -0.4153
61 P L -0.3800
62 A L -0.3645
63 R L -0.4399
64 F L 0.0000
65 S L -0.8569
66 G L 0.0000
67 S L -0.2294
68 L L 0.3696
69 I L 0.8690
70 G L -0.2749
71 N L -1.2074
72 K L -1.1153
73 A L 0.0000
74 A L 0.0000
75 L L 0.0000
76 T L -0.2100
77 I L 0.0000
78 T L -0.7462
79 G L -1.1139
80 A L 0.0000
81 Q L -2.0274
82 T L -1.8733
83 E L -2.5521
84 D L 0.0000
85 E L -2.0549
86 A L 0.0000
87 I L -0.4431
88 Y L 0.0000
89 F L 0.0000
90 C L 0.0000
91 A L 0.0000
92 L L 0.0000
93 W L 0.0016
94 Y L -0.2358
95 S L -0.8117
96 N L -1.7117
97 H L -1.1642
98 W L 0.0000
99 V L 0.4237
100 F L 0.0000
101 G L 0.0000
102 G L -1.0562
103 G L -0.9412
104 T L 0.0000
105 K L -1.7322
106 L L 0.0000
107 T L -0.5137
108 V L 0.0000
109 L L 0.3282
110 E L -1.2233
301 Q H -1.4173
302 V H -0.9585
303 Q H -1.8934
304 L H 0.0000
305 Q H -2.1488
306 Q H 0.0000
307 P H -1.0496
308 G H -0.9904
309 A H -0.1343
310 E H -0.2743
311 L H 0.9509
312 V H -0.2331
313 K H -1.7242
314 P H -1.3852
315 G H -1.1681
316 A H -0.8939
317 S H -1.0932
318 V H 0.0000
319 K H -2.0358
320 L H 0.0000
321 S H -0.8419
322 C H 0.0000
323 K H -1.5108
324 A H 0.0000
325 S H -1.0810
326 G H -0.7666
327 Y H -0.2334
328 T H 0.0195
329 F H 0.0000
330 T H -0.7694
331 S H 0.0640
332 Y H 0.4264
333 W H 0.2452
334 M H 0.0000
335 H H 0.0000
336 W H 0.0000
337 V H 0.0000
338 K H 0.0000
339 Q H -1.0794
340 R H -1.7631
341 P H -1.3205
342 G H -1.7351
343 R H -2.5718
344 G H -1.5555
345 L H 0.0000
346 E H -1.1880
347 W H 0.0000
348 I H 0.0000
349 G H 0.0000
350 R H -0.4889
351 I H 0.0000
352 D H -0.7333
353 P H 0.0000
354 N H -1.7070
355 S H -1.0851
356 G H -1.1375
357 G H -0.8647
358 T H -0.5783
359 K H -1.4131
360 Y H -1.7588
361 N H -2.3491
362 E H -3.5467
363 K H -3.2312
364 F H 0.0000
365 K H -3.0809
366 S H -1.8043
367 K H -1.5914
368 A H 0.0000
369 T H -0.8396
370 L H 0.0000
371 T H -0.3812
372 V H -0.7978
373 D H -1.3897
374 K H -1.9658
375 P H -1.1029
376 S H -0.9874
377 S H -1.0490
378 T H 0.0000
379 A H 0.0000
380 Y H -0.4890
381 M H 0.0000
382 Q H -1.4141
383 L H 0.0000
384 S H -0.8860
385 S H -0.8127
386 L H 0.0000
387 T H -1.2569
388 S H -1.4553
389 E H -2.0205
390 D H 0.0000
391 S H -0.6757
392 A H 0.0000
393 V H -0.3829
394 Y H 0.0000
395 Y H 0.0000
396 C H 0.0000
397 A H 0.0000
398 R H 0.0000
399 Y H 0.0000
400 D H 0.6465
401 Y H 1.3696
402 Y H 1.5072
403 G H 0.3468
404 S H -0.1722
405 S H 0.1732
406 Y H -0.0746
407 F H 0.0000
408 D H 0.0000
409 Y H 0.1897
410 W H 0.0000
411 G H 0.0000
412 Q H -1.6990
413 G H -0.8401
414 T H 0.0000
415 T H -0.2345
416 V H 0.0000
417 T H -0.1431
418 V H 0.0000
419 S H -0.5692
420 S H -0.7112

 

Laboratory of Theory of Biopolymers 2015