Project name: 1CD9

Status: done

submitted: 2017-03-17 07:19:35, status changed: 2017-03-17 07:44:14
Settings
Chain sequence(s) A: GPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
C: ASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
B: AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM
D: GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.8457
Maximal score value
1.8932
Average score
-0.6446
Total score value
-483.4724

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 G A -0.7202
6 P A -0.6852
7 A A 0.0000
8 S A 0.0000
9 S A -0.0278
10 L A 0.0000
11 P A -0.3309
12 Q A -0.7345
13 S A -0.4588
14 F A 0.0000
15 L A 0.0000
16 L A -0.3926
17 K A -0.3250
18 C A 0.0000
19 L A 0.0000
20 E A 0.0000
21 Q A 0.0000
22 V A 0.0000
23 R A -1.1076
24 K A -1.0210
25 I A 0.0000
26 Q A -0.9900
27 G A -1.1016
28 D A -1.1051
29 G A -0.9773
30 A A -1.1040
31 A A -1.1472
32 L A 0.0000
33 Q A -1.5244
34 E A -2.4078
35 K A -2.1128
36 L A 0.0000
37 C A -1.4109
38 A A -1.0684
39 T A -1.0452
40 Y A -0.6261
41 K A -1.7309
42 L A -1.2510
43 C A -1.4810
44 H A -1.9930
45 P A -1.3482
46 E A -2.1663
47 E A -2.1160
48 L A 0.0000
49 V A 1.0559
50 L A 1.6216
51 L A 0.8226
52 G A 0.5490
53 H A -0.4394
54 S A -0.0916
55 L A -0.1733
56 G A -0.5220
57 I A 0.0000
58 P A 0.3059
59 W A 1.0340
60 A A 0.0000
61 P A 0.1731
62 L A -0.0131
63 S A -0.3499
64 S A -0.4586
65 C A 0.0000
66 P A -0.7437
67 S A -0.7379
68 Q A -0.7837
69 A A -0.3616
70 L A 0.1500
71 Q A -1.0326
72 L A 0.0000
73 A A -0.4421
74 G A -0.5930
75 C A 0.0000
76 L A 0.0000
77 S A -0.2559
78 Q A -0.3678
79 L A 0.0000
80 H A 0.0000
81 S A -0.4068
82 G A 0.0000
83 L A 0.0000
84 F A 0.0062
85 L A -0.0187
86 Y A 0.0000
87 Q A -0.5098
88 G A -0.6411
89 L A 0.0000
90 L A 0.0000
91 Q A -1.9971
92 A A -1.2818
93 L A 0.0000
94 E A -2.5473
95 G A -2.1571
96 I A 0.0000
97 S A -1.3309
98 P A -1.2520
99 E A -2.1613
100 L A 0.0000
101 G A -1.6402
102 P A -1.3518
103 T A -1.2616
104 L A 0.0000
105 D A -2.1942
106 T A -1.0950
107 L A 0.0000
108 Q A -0.9705
109 L A -0.5759
110 D A -0.4385
111 V A 0.0000
112 A A 0.0089
113 D A -0.1692
114 F A 0.0000
115 A A 0.0000
116 T A -0.1610
117 T A 0.0000
118 I A 0.0000
119 W A -0.6227
120 Q A -1.1036
121 Q A -1.0658
122 M A 0.0000
123 E A -1.8377
124 E A -1.9083
125 L A 0.0000
126 G A -1.3633
127 M A -0.6526
128 A A -0.6218
129 P A -0.0088
130 A A 0.4680
131 L A 0.9315
132 Q A -0.6767
133 P A -0.6388
134 T A -0.7160
135 Q A -1.3826
136 G A -0.4540
137 A A -0.1960
138 M A -0.0661
139 P A 0.0482
140 A A -0.0237
141 F A 0.0000
142 A A 0.0857
143 S A 0.1249
144 A A 0.2993
145 F A 0.9875
146 Q A 0.0316
147 R A -0.8917
148 R A -0.3144
149 A A 0.0000
150 G A 0.0000
151 G A 0.0000
152 V A 0.0000
153 L A 0.0000
154 V A 0.0000
155 A A 0.0000
156 S A -0.5422
157 H A -0.3088
158 L A 0.0000
159 Q A -0.8486
160 S A -0.5348
161 F A 0.0000
162 L A 0.0000
163 E A -1.2478
164 V A -0.3547
165 S A 0.0000
166 Y A -1.3038
167 R A -2.3911
168 V A 0.0000
169 L A 0.0000
170 R A -2.4256
171 H A -2.4387
172 L A -1.4336
173 A A 0.0000
174 Q A -1.9264
175 P A -1.1614
1 A B 0.0101
2 G B 0.2100
3 Y B 1.0149
4 P B 0.4513
5 P B -0.4916
6 A B -1.0590
7 S B -1.2951
8 P B 0.0000
9 S B -1.7877
10 N B -1.9659
11 L B -1.3945
12 S B -0.7286
13 C B 0.0000
14 L B 0.0699
15 M B 0.0000
16 H B -0.6173
17 L B -0.7709
18 T B -0.4425
19 T B -0.4411
20 N B -0.9469
21 S B -0.6353
22 L B 0.0000
23 V B -0.1369
24 C B 0.0000
25 Q B -1.8671
26 W B 0.0000
27 E B -2.6389
28 P B -1.8456
29 G B -1.4910
30 P B -1.4687
31 E B -2.1075
32 T B -0.8258
33 H B -1.2794
34 L B -0.2194
35 P B -0.6091
36 T B -1.0143
37 S B -0.8364
38 F B -0.8436
39 I B -0.1429
40 L B 0.0000
41 K B -1.3228
42 S B 0.0000
43 F B 0.0000
44 R B -1.1444
45 S B 0.0000
46 R B -0.9438
47 A B -0.8988
48 D B -1.7832
49 C B -1.3792
50 Q B -1.4686
51 Y B -0.5483
52 Q B -1.5539
53 G B -1.7180
54 D B -2.2621
55 T B -1.7219
56 I B 0.0000
57 P B -1.2498
58 D B -1.5633
59 C B -0.2652
60 V B 0.7362
61 A B -1.1769
62 K B -2.9450
63 K B -3.6592
64 R B -3.7137
65 Q B -3.3710
66 N B -2.8874
67 N B -1.8200
68 C B 0.0000
69 S B -0.0600
70 I B 0.0000
71 P B -0.9032
72 R B 0.0000
73 K B -1.7987
74 N B -1.1040
75 L B 0.0000
76 L B 0.0000
77 L B 0.0000
78 Y B 0.0000
79 Q B -0.2204
80 Y B 0.0635
81 M B 0.0000
82 A B 0.0000
83 I B 0.0000
84 W B -1.0505
85 V B 0.0000
86 Q B -1.1334
87 A B 0.0000
88 E B -1.2060
89 N B 0.0623
90 M B 1.3056
91 L B 1.5363
92 G B 0.3304
93 S B -0.9086
94 S B -1.4723
95 E B -2.4848
96 S B 0.0000
97 P B -1.5571
98 K B -1.8231
99 L B -0.4995
100 C B -0.4802
101 L B 0.0000
102 D B 0.0000
103 P B 0.0000
104 M B 0.0000
105 D B -0.0839
106 V B 0.1617
107 V B 0.0000
108 K B -0.9600
109 L B 0.0000
110 E B -1.6879
111 P B -0.6384
112 P B 0.0000
113 M B -0.1256
114 L B 0.0000
115 Q B -1.0885
116 A B -0.8644
117 L B -0.6435
118 D B -0.7138
119 I B 1.3004
127 Q B -1.1048
128 P B -0.5809
129 G B 0.0000
130 C B 0.0000
131 L B 0.0000
132 W B -0.8469
133 L B 0.0000
134 S B -1.6941
135 W B 0.0000
136 K B -1.4444
137 P B 0.0000
138 W B -1.4142
139 K B -2.4057
140 P B -1.6005
141 S B 0.0000
142 E B -2.7513
143 Y B -1.5669
144 M B 0.0000
145 E B -1.4072
146 Q B 0.0000
147 E B -0.8651
148 C B 0.0000
149 E B -0.4297
150 L B 0.0000
151 R B -0.3430
152 Y B -0.3681
153 Q B -0.7768
154 P B 0.0000
155 Q B -1.3326
156 L B -0.8041
157 K B -1.7806
158 G B -1.4366
159 A B -1.3258
160 N B -1.7460
161 W B -0.6884
162 T B -0.3910
163 L B -0.1017
164 V B 0.1504
165 F B 0.0000
166 H B -0.5646
167 L B 0.0000
168 P B -0.7902
169 S B -1.0982
170 S B -1.4207
171 K B -2.1350
172 D B -2.7233
173 Q B -2.5198
174 F B -1.6814
175 E B -1.7664
176 L B 0.0000
177 C B -0.5048
178 G B -0.8543
179 L B 0.0000
180 H B -1.5809
181 Q B -1.7773
182 A B -1.2597
183 P B -1.0043
184 V B -1.3580
185 Y B 0.0000
186 T B -0.9751
187 L B 0.0000
188 Q B -0.6410
189 M B 0.0000
190 R B -0.5873
191 C B 0.0000
192 I B 0.1428
193 R B 0.0000
194 S B -0.5895
195 S B -0.4830
196 L B -0.1432
197 P B 0.0638
198 G B 0.6721
199 F B 1.8932
200 W B 0.9121
201 S B 0.0000
202 P B -0.4093
203 W B -0.4542
204 S B 0.0000
205 P B -0.4815
206 G B -0.6904
207 L B -0.9399
208 Q B -1.6251
209 L B -1.3711
210 R B -1.8744
211 P B -0.9562
212 T B -0.3636
213 M B 0.3949
7 A C -0.2043
8 S C -0.1868
9 S C -0.1714
10 L C 0.0000
11 P C -0.2514
12 Q C -0.6162
13 S C -0.3726
14 F C 0.0000
15 L C 0.0000
16 L C -0.6152
17 K C -0.3133
18 C C 0.0000
19 L C 0.0000
20 E C 0.0000
21 Q C 0.0000
22 V C 0.0000
23 R C -1.2165
24 K C -0.8159
25 I C 0.0000
26 Q C -1.0371
27 G C -1.0579
28 D C -0.9773
29 G C 0.0000
30 A C -0.9583
31 A C -0.9818
32 L C 0.0000
33 Q C -1.2646
34 E C -2.1238
35 K C -1.5596
36 L C 0.0000
37 C C -1.1137
38 A C -0.8667
39 T C -0.7837
40 Y C -0.5103
41 K C -1.6168
42 L C -1.0672
43 C C -1.2940
44 H C -1.9087
45 P C -1.2599
46 E C -2.1194
47 E C -1.9986
48 L C -0.1303
49 V C 1.1874
50 L C 1.6510
51 L C 0.8163
52 G C 0.4907
53 H C -0.4466
54 S C -0.4546
55 L C 0.0000
56 G C -0.6415
57 I C 0.0000
58 P C 0.0127
59 W C 0.5634
60 A C 0.0000
61 P C -0.1195
62 L C -0.0127
63 S C -0.5309
64 S C -0.4966
65 C C 0.0000
66 P C -1.0010
67 S C -1.0335
68 Q C -1.3864
69 A C -0.4459
70 L C -0.2726
71 Q C -1.1912
72 L C 0.0000
73 A C -0.3378
74 G C 0.0000
75 C C 0.0000
76 L C 0.0000
77 S C -0.1018
78 Q C -0.4384
79 L C 0.0000
80 H C 0.0000
81 S C -0.2803
82 G C 0.0000
83 L C 0.0000
84 F C 0.1412
85 L C 0.0302
86 Y C 0.0000
87 Q C -0.4702
88 G C -0.5734
89 L C 0.0000
90 L C 0.0000
91 Q C -2.0406
92 A C -1.2435
93 L C 0.0000
94 E C -2.4956
95 G C -2.0273
96 I C 0.0000
97 S C -1.0443
98 P C -0.9291
99 E C -1.4422
100 L C 0.0000
101 G C -1.4647
102 P C -1.2320
103 T C -1.2735
104 L C 0.0000
105 D C -2.5372
106 T C -1.3098
107 L C 0.0000
108 Q C -1.0773
109 L C -0.7625
110 D C 0.0000
111 V C 0.0000
112 A C 0.0236
113 D C -0.0658
114 F C 0.0000
115 A C 0.0000
116 T C -0.0743
117 T C 0.0000
118 I C 0.0000
119 W C -0.7600
120 Q C -1.6718
121 Q C 0.0000
122 M C 0.0000
123 E C -2.9381
124 E C -2.9761
125 L C 0.0000
126 G C -1.8503
127 M C -1.0028
128 A C -0.9818
129 P C -0.1611
130 A C 0.4277
131 L C 0.9464
132 Q C -0.5663
133 P C -0.4483
134 T C -0.5136
135 Q C -0.8089
136 G C -0.5986
137 A C -0.1710
138 M C -0.0389
139 P C -0.0237
140 A C -0.2012
141 F C 0.0000
142 A C -0.1081
143 S C 0.1280
144 A C 0.1469
145 F C 0.9876
146 Q C 0.0826
147 R C -0.5926
148 R C -0.1551
149 A C 0.0000
150 G C 0.0000
151 G C 0.0000
152 V C 0.0000
153 L C 0.0000
154 V C 0.0000
155 A C 0.0000
156 S C -0.5508
157 H C -0.3659
158 L C 0.0000
159 Q C -0.9542
160 S C -0.7254
161 F C 0.0000
162 L C 0.0000
163 E C -1.9933
164 V C -0.7872
165 S C 0.0000
166 Y C -1.4875
167 R C -2.4489
168 V C -1.3660
169 L C 0.0000
170 R C -2.2707
171 H C -2.1863
172 L C -1.0837
173 A C 0.0000
174 Q C -1.8265
175 P C -1.1350
2 G D -0.3443
3 Y D 0.0338
4 P D -0.0412
5 P D -0.7540
6 A D -0.6607
7 S D -0.9919
8 P D 0.0000
9 S D -1.6621
10 N D -1.9482
11 L D -1.4349
12 S D -0.8227
13 C D 0.0000
14 L D -0.1992
15 M D 0.0000
16 H D -0.8106
17 L D 0.0000
18 T D -0.5554
19 T D -0.5026
20 N D -1.0402
21 S D 0.0000
22 L D 0.0000
23 V D 0.0000
24 C D 0.0000
25 Q D -2.1546
26 W D 0.0000
27 E D -2.4500
28 P D -1.6803
29 G D -1.3171
30 P D -1.5597
31 E D -2.1589
32 T D -1.4504
33 H D -1.3627
34 L D -0.2208
35 P D -0.3108
36 T D -0.7040
37 S D -0.8417
38 F D -0.9100
39 I D 0.0000
40 L D 0.0000
41 K D -0.9353
42 S D 0.0000
43 F D 0.0000
44 R D -1.4742
45 S D 0.0000
46 R D -2.1730
47 A D -1.4951
48 D D -2.1286
49 C D -1.8490
50 Q D -1.7127
51 Y D -0.7997
52 Q D -1.6265
53 G D -1.7774
54 D D -2.1820
55 T D -1.6494
56 I D 0.0000
57 P D -1.0913
58 D D -1.2198
59 C D -0.1670
60 V D 0.6848
61 A D -1.4024
62 K D -3.1005
63 K D -3.6144
64 R D -3.8457
65 Q D -3.5072
66 N D -2.9393
67 N D -2.1276
68 C D 0.0000
69 S D -0.1810
70 I D 0.0000
71 P D -0.9254
72 R D 0.0000
73 K D -2.0915
74 N D -1.1223
75 L D 0.0000
76 L D -0.2068
77 L D 0.0000
78 Y D 0.0000
79 Q D -0.5375
80 Y D -0.5666
81 M D 0.0000
82 A D 0.0000
83 I D 0.0000
84 W D -0.8219
85 V D 0.0000
86 Q D -1.0256
87 A D 0.0000
88 E D -1.8136
89 N D -0.2943
90 M D 0.9855
91 L D 1.0107
92 G D -0.0733
93 S D -1.0464
94 S D -1.3110
95 E D -1.9092
96 S D 0.0000
97 P D -1.3955
98 K D -1.6885
99 L D -0.4668
100 C D -0.6402
101 L D 0.0000
102 D D 0.0000
103 P D 0.0000
104 M D 0.0000
105 D D -0.1413
106 V D -0.0026
107 V D 0.0000
108 K D -1.3866
109 L D 0.0000
110 E D -1.9089
111 P D -0.7631
112 P D 0.0000
113 M D -0.3343
114 L D -0.2105
115 Q D -0.6253
116 A D -0.8181
117 L D -1.0054
118 D D -1.8418
127 Q D -1.2436
128 P D -0.5893
129 G D 0.0000
130 C D 0.0000
131 L D 0.0000
132 W D -1.0564
133 L D 0.0000
134 S D 0.0000
135 W D 0.0000
136 K D -2.0583
137 P D -1.8587
138 W D -1.6652
139 K D -2.6082
140 P D -1.7256
141 S D 0.0000
142 E D -2.9810
143 Y D -1.6977
144 M D 0.0000
145 E D -2.0211
146 Q D 0.0000
147 E D -0.9512
148 C D 0.0000
149 E D -0.3980
150 L D 0.0000
151 R D -0.3876
152 Y D -0.3532
153 Q D 0.0000
154 P D -1.4768
155 Q D -1.4452
156 L D -1.1328
157 K D -1.9541
158 G D -1.5318
159 A D -1.1962
160 N D -1.6693
161 W D -0.5760
162 T D -0.3251
163 L D 0.0194
164 V D 0.0000
165 F D 0.0000
166 H D -0.6723
167 L D 0.0000
168 P D -0.9833
169 S D -1.2802
170 S D -1.5835
171 K D -2.1561
172 D D -2.7233
173 Q D -2.4459
174 F D 0.0000
175 E D -1.8184
176 L D 0.0000
177 C D -0.4833
178 G D -0.8378
179 L D 0.0000
180 H D -1.7398
181 Q D -1.8071
182 A D -1.2720
183 P D -1.0207
184 V D -1.3556
185 Y D 0.0000
186 T D -0.8830
187 L D 0.0000
188 Q D -0.5470
189 M D 0.0000
190 R D -0.5324
191 C D 0.0000
192 I D 0.0071
193 R D 0.0000
194 S D -0.7749
195 S D -0.5898
196 L D -0.1885
197 P D 0.0231
198 G D 0.4988
199 F D 1.5879
200 W D 0.8366
201 S D 0.0000
202 P D -0.4853
203 W D -0.4185
204 S D 0.0000
205 P D -0.5055
206 G D -0.7396
207 L D -0.8110
208 Q D -1.5773
209 L D -1.3882
210 R D -1.9193
211 P D 0.0000
212 T D -0.4232
213 M D 0.2819

 

Laboratory of Theory of Biopolymers 2015