Project name: d089c6e3d084642

Status: done

submitted: 2017-12-06 11:48:14, status changed: 2017-12-06 13:08:05
Settings
Chain sequence(s) A: EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYYADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCTIAALLSPYSYSWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYYADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCTIAALLSPYSYSWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.3344
Maximal score value
2.0645
Average score
-0.7582
Total score value
-1009.9147

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.2700
2 V A 0.4122
3 Q A 0.0528
4 L A 0.0000
5 V A 0.6812
6 E A 0.0000
7 S A -0.5285
8 G A -0.6818
9 G A -0.5970
10 G A -0.1592
11 V A 0.5513
12 V A -0.5117
13 Q A -1.4698
14 P A -2.2909
15 G A -2.3971
16 R A -2.7916
17 S A -2.5051
18 L A -1.4935
19 R A -2.0800
20 L A 0.0000
21 S A -0.5728
22 C A 0.0000
23 S A -0.6636
24 A A 0.0000
25 S A -0.4137
26 G A -0.4358
27 F A 0.1998
28 T A 0.0513
29 F A 0.0000
30 S A -0.6347
31 G A 0.0179
32 Y A 0.9233
33 G A 0.4885
34 L A 0.0000
35 S A 0.3329
36 W A 0.0000
37 V A 0.0000
38 R A -0.8568
39 Q A -1.2123
40 A A -1.5000
41 P A -1.2701
42 G A -1.6235
43 K A -2.5548
44 G A -1.9122
45 L A 0.0000
46 E A -1.5484
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 M A 0.9079
51 I A 0.0000
52 S A 0.3206
53 S A 0.0000
54 G A -0.7622
55 G A -0.4359
56 S A -0.0516
57 Y A 1.2240
58 T A 1.0210
59 Y A 1.3573
60 Y A -0.3203
61 A A -1.1090
62 D A -2.3268
63 S A -1.8846
64 V A 0.0000
65 K A -2.5441
66 G A -2.1521
67 R A -2.2055
68 F A 0.0000
69 A A -1.0551
70 I A 0.0000
71 S A -0.6814
72 R A -1.4527
73 D A -1.8773
74 N A -2.1834
75 A A -1.6214
76 K A -2.4550
77 N A -2.0181
78 T A 0.0000
79 L A 0.0000
80 F A -0.6792
81 L A 0.0000
82 Q A -1.4686
83 M A 0.0000
84 D A -2.7188
85 S A -2.1838
86 L A 0.0000
87 R A -3.2999
88 P A -2.2188
89 E A -2.5647
90 D A 0.0000
91 T A -0.9312
92 G A 0.0000
93 V A -0.0189
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 T A 0.0503
98 I A 0.0000
99 A A 0.0000
100 A A 0.0000
101 L A 1.3323
102 L A 1.7937
103 S A 0.5392
104 P A -0.0148
105 Y A 0.1588
106 S A -0.4382
107 Y A 0.0000
108 S A -0.0671
109 W A 0.0000
110 G A 0.0000
111 Q A -0.3616
112 G A 0.0000
113 T A 0.0000
114 P A -0.3125
115 V A 0.0000
116 T A -0.3940
117 V A 0.0000
118 S A -1.0501
119 S A -0.6768
120 A A -0.4274
121 S A -0.5150
122 T A -0.8171
123 K A -1.7450
124 G A -1.7517
125 P A -1.0674
126 S A -0.4357
127 V A 0.0000
128 F A -0.6177
129 P A -1.0675
130 L A 0.0000
131 A A -0.8976
132 P A 0.0000
133 S A -1.0453
134 S A -1.0827
135 K A -1.9093
136 S A -1.3581
137 T A -1.1064
138 S A -0.8992
139 G A -0.8606
140 G A -0.9011
141 T A -0.7599
142 A A -0.4994
143 A A 0.0000
144 L A 0.0000
145 G A 0.0000
146 C A 0.0000
147 L A 0.0000
148 V A 0.0000
149 K A 0.0000
150 D A -1.4138
151 Y A 0.0000
152 F A 0.0000
153 P A -1.1073
154 E A -1.4739
155 P A -1.1758
156 V A -0.8686
157 T A -0.6138
158 V A -0.1854
159 S A -0.4245
160 W A 0.0000
161 N A -0.6741
162 S A -0.6765
163 G A -0.5778
164 A A -0.2547
165 L A -0.0146
166 T A -0.2027
167 S A -0.1818
168 G A -0.1813
169 V A 0.0775
170 H A -0.1511
171 T A 0.0162
172 F A 0.0000
173 P A -0.4011
174 A A -0.1145
175 V A 0.1269
176 L A 0.4119
177 Q A -0.2048
178 S A -0.2114
179 S A -0.4855
180 G A -0.3261
181 L A 0.0000
182 Y A 0.0000
183 S A 0.0000
184 L A 0.0000
185 S A 0.0000
186 S A 0.0000
187 V A 0.0000
188 V A 0.0000
189 T A -0.1204
190 V A 0.0000
191 P A -0.5375
192 S A -0.6386
193 S A -0.5518
194 S A -0.6963
195 L A -0.8700
196 G A -1.0660
197 T A -0.8904
198 Q A -1.5464
199 T A -1.1840
200 Y A 0.0000
201 I A -1.1443
202 C A 0.0000
203 N A -1.4280
204 V A 0.0000
205 N A -1.7742
206 H A 0.0000
207 K A -2.8765
208 P A -1.8884
209 S A -2.0635
210 N A -2.6500
211 T A -2.0745
212 K A -2.5449
213 V A -1.3234
214 D A -2.3834
215 K A -1.8710
216 K A -2.0692
217 V A 0.0000
218 E A -2.6036
219 P A -1.6009
220 K A -1.7082
221 S A -1.5036
222 C A -1.4188
223 D A -2.7911
224 K A -3.2860
225 T A -2.1898
226 H A -2.3968
227 T A -1.4921
228 C A -0.0567
229 P A -0.3706
230 P A 0.0627
231 C A 0.4805
232 P A -0.1651
233 A A -0.9514
234 P A -1.0514
235 E A -1.3455
236 L A 1.2540
237 L A 1.5202
238 G A 0.2670
239 G A -0.2064
240 P A 0.0000
241 S A 0.1153
242 V A 0.0000
243 F A 1.1785
244 L A 1.0166
245 F A 1.3746
246 P A 0.0073
247 P A 0.0000
248 K A -2.1682
249 P A -1.3236
250 K A -1.0535
251 D A 0.0000
252 T A 0.0000
253 L A -0.2154
254 M A 0.4046
255 I A 1.3377
256 S A -0.1169
257 R A -1.6491
258 T A -0.8568
259 P A 0.0000
260 E A -1.1879
261 V A 0.0000
262 T A 0.4580
263 C A 0.0000
264 V A 0.0000
265 V A 0.0000
266 V A -0.8595
267 D A -1.1909
268 V A 0.0000
269 S A -1.6669
270 H A -2.1363
271 E A -2.8377
272 D A -2.3497
273 P A -2.3197
274 E A -2.9311
275 V A -1.9037
276 K A -2.2782
277 F A -1.4174
278 N A -1.7864
279 W A 0.0000
280 Y A -1.3182
281 V A -1.0366
282 D A -2.1398
283 G A -0.8822
284 V A 0.3271
285 E A -1.5600
286 V A -1.0210
287 H A -2.1589
288 N A -2.2474
289 A A -1.7698
290 K A -2.5273
291 T A -2.0253
292 K A -2.7348
293 P A -2.5010
294 R A -3.8873
295 E A -4.3344
296 E A -3.7716
297 Q A -2.5808
298 Y A -0.1888
299 N A -1.2826
300 S A -1.2361
301 T A -1.9052
302 Y A -2.9766
303 R A -3.4699
304 V A 0.0000
305 V A 0.0000
306 S A 0.0000
307 V A 0.0000
308 L A 0.0000
309 T A -0.7274
310 V A 0.0000
311 L A 0.1790
312 H A -0.4769
313 Q A -1.4376
314 D A -1.4454
315 W A 0.0000
316 L A -0.9425
317 N A -1.9882
318 G A -1.9311
319 K A -1.9001
320 E A -2.1530
321 Y A 0.0000
322 K A -1.6886
323 C A 0.0000
324 K A -1.7178
325 V A 0.0000
326 S A -1.3733
327 N A 0.0000
328 K A -2.4816
329 A A -1.5825
330 L A -0.5105
331 P A -0.4408
332 A A -0.4496
333 P A -0.7032
334 I A -0.4355
335 E A -1.5965
336 K A -1.1579
337 T A -0.9781
338 I A -0.2162
339 S A -1.0207
340 K A -1.1805
341 A A -0.9569
342 K A -2.1918
343 G A -1.7838
344 Q A -1.9739
345 P A -2.0908
346 R A -2.4521
347 E A -2.7283
348 P A 0.0000
349 Q A -1.2486
350 V A 0.0000
351 Y A 0.0000
352 T A -0.6377
353 L A 0.0000
354 P A -0.4346
355 P A -0.8980
356 S A -1.5321
357 R A -2.7553
358 D A -2.7822
359 E A 0.0000
360 L A -1.6579
361 T A -1.4700
362 K A -2.0435
363 N A -2.2948
364 Q A -2.1364
365 V A 0.0000
366 S A 0.0000
367 L A 0.0000
368 T A 0.0000
369 C A 0.0000
370 L A 0.0000
371 V A 0.0000
372 K A -0.5274
373 G A -1.1178
374 F A 0.0000
375 Y A -1.1470
376 P A 0.0000
377 S A -0.2821
378 D A -1.0292
379 I A 0.0000
380 A A -0.5718
381 V A 0.0000
382 E A -1.1099
383 W A 0.0000
384 E A -1.5848
385 S A 0.0000
386 N A -1.7543
387 G A -1.8561
388 Q A -2.2695
389 P A -1.8828
390 E A 0.0000
391 N A -2.0685
392 N A -1.6001
393 Y A -1.0720
394 K A -1.1251
395 T A -0.4399
396 T A 0.0000
397 P A -0.1468
398 P A 0.0776
399 V A 0.4185
400 L A 0.6009
401 D A -0.6046
402 S A -1.2330
403 D A -1.8682
404 G A -0.9228
405 S A 0.0000
406 F A 0.0730
407 F A 0.0000
408 L A 0.0000
409 Y A 0.0000
410 S A 0.0000
411 K A 0.0000
412 L A 0.0000
413 T A -0.9149
414 V A 0.0000
415 D A -2.3106
416 K A -2.1852
417 S A -1.8581
418 R A -1.5704
419 W A 0.0000
420 Q A -1.7495
421 Q A -1.9175
422 G A -1.1521
423 N A -0.4162
424 V A 0.9035
425 F A 0.0000
426 S A -0.6170
427 C A 0.0000
428 S A 0.0000
429 V A 0.0000
430 M A 0.0000
431 H A 0.0000
432 E A -1.1622
433 A A -1.7927
434 L A 0.0000
435 H A -1.9486
436 N A -1.8241
437 H A -1.4057
438 Y A -0.5591
439 T A -0.8277
440 Q A -1.1743
441 K A -1.0493
442 S A -0.3608
443 L A 0.0000
444 S A 0.2111
445 L A -0.3193
446 S A -0.8548
447 P A -0.9766
448 G A -1.4364
449 K A -2.3565
450 E B -1.7991
451 V B -0.6031
452 Q B -0.7120
453 L B 0.0000
454 V B 1.2352
455 E B 0.2597
456 S B -0.5111
457 G B -0.6800
458 G B -0.5678
459 G B -0.1097
460 V B 0.7380
461 V B 0.0000
462 Q B -1.3079
463 P B -2.1337
464 G B -2.2448
465 R B -2.7439
466 S B -2.3265
467 L B -1.5982
468 R B -2.2393
469 L B 0.0000
470 S B -0.4776
471 C B 0.0000
472 S B -0.3809
473 A B 0.0000
474 S B -0.2763
475 G B -0.3674
476 F B 1.0941
477 T B 0.4501
478 F B 0.0000
479 S B -0.7102
480 G B -0.1417
481 Y B 0.2033
482 G B 0.0000
483 L B 0.0000
484 S B 0.0000
485 W B 0.0000
486 V B 0.0000
487 R B -0.5621
488 Q B -0.9138
489 A B -1.3585
490 P B -1.2451
491 G B -1.6136
492 K B -2.4311
493 G B -1.6599
494 L B 0.0000
495 E B -0.8690
496 W B 0.0000
497 V B 0.0000
498 A B 0.0000
499 M B 0.0000
500 I B 0.0000
501 S B 0.0710
502 S B 0.0000
503 G B -0.8440
504 G B -0.3786
505 S B -0.1648
506 Y B 1.1666
507 T B 1.0355
508 Y B 0.9509
509 Y B -0.3104
510 A B -1.1739
511 D B -2.3166
512 S B -1.7367
513 V B 0.0000
514 K B -2.4971
515 G B -1.9198
516 R B -1.7166
517 F B 0.0000
518 A B -0.9958
519 I B -0.0356
520 S B -0.4657
521 R B -1.4878
522 D B -2.0333
523 N B -2.2350
524 A B -1.6843
525 K B -2.6191
526 N B -1.9634
527 T B 0.0000
528 L B 0.0000
529 F B -0.6265
530 L B 0.0000
531 Q B -1.8205
532 M B 0.0000
533 D B -2.7320
534 S B -1.9844
535 L B 0.0000
536 R B -2.3197
537 P B -1.8385
538 E B -2.2889
539 D B 0.0000
540 T B -0.8752
541 G B -0.6988
542 V B 0.1126
543 Y B 0.0000
544 F B 0.0000
545 C B 0.0000
546 T B 0.0000
547 I B 0.0000
548 A B 0.0000
549 A B 0.0000
550 L B 0.0000
551 L B 0.0000
552 S B 0.2484
553 P B 0.6362
554 Y B 1.1919
555 S B 0.9155
556 Y B 1.3714
557 S B 0.5526
558 W B 0.4382
559 G B 0.0000
560 Q B 0.0406
561 G B 0.0000
562 T B 0.0000
563 P B -0.1285
564 V B -0.0653
565 T B -0.2364
566 V B 0.0000
567 S B -0.3724
568 S B -0.2674
569 A B 0.0000
570 S B -0.2014
571 T B 0.0000
572 K B -0.5719
573 G B 0.0000
574 P B -0.5467
575 S B -0.0409
576 V B 1.0687
577 F B 2.0645
578 P B 0.9265
579 L B 0.6129
580 A B -0.6385
581 P B -0.4184
582 S B -0.4361
583 S B -1.1569
584 K B 0.0000
585 S B -1.4521
586 T B 0.0000
587 S B -1.4029
588 G B -1.0412
589 G B -0.6154
590 T B -0.3795
591 A B -0.2557
592 A B 0.0000
593 L B 0.0000
594 G B 0.0000
595 C B 0.0000
596 L B 0.0000
597 V B 0.0000
598 K B 0.0000
599 D B -0.4530
600 Y B 0.0000
601 F B 0.0000
602 P B 0.0000
603 E B -0.7661
604 P B -0.8271
605 V B -0.7458
606 T B -0.6858
607 V B -0.3910
608 S B -0.4486
609 W B 0.0000
610 N B -0.7742
611 S B -0.6963
612 G B -0.6077
613 A B -0.2692
614 L B 0.0013
615 T B -0.1866
616 S B -0.2024
617 G B -0.3035
618 V B 0.1047
619 H B -0.2136
620 T B -0.0360
621 F B 0.0000
622 P B -0.4828
623 A B 0.0379
624 V B 0.3591
625 L B 1.2737
626 Q B 0.1791
627 S B -0.0052
628 S B -0.1669
629 G B 0.3756
630 L B 0.4759
631 Y B 0.0000
632 S B 0.0000
633 L B 0.0000
634 S B 0.0000
635 S B 0.0000
636 V B 0.0000
637 V B 0.0000
638 T B -0.2563
639 V B 0.0000
640 P B -0.3799
641 S B -0.5552
642 S B -0.7053
643 S B -0.7540
644 L B -1.2357
645 G B -1.6695
646 T B -0.9583
647 Q B -1.4560
648 T B -1.2938
649 Y B 0.0000
650 I B -1.4722
651 C B 0.0000
652 N B -1.5516
653 V B 0.0000
654 N B -1.9803
655 H B 0.0000
656 K B -2.7724
657 P B -1.5061
658 S B -1.3396
659 N B -2.4828
660 T B -1.8266
661 K B -2.6332
662 V B -1.2685
663 D B -2.4614
664 K B -2.5452
665 K B -2.7866
666 V B 0.0000
667 E B -2.9406
668 P B -2.3356
669 K B -2.4206
670 S B -1.6259
671 C B -0.9986
672 D B -1.9270
673 K B -2.7534
674 T B -1.5384
675 H B -1.5837
676 T B -0.5671
677 C B 0.3811
678 P B 0.0718
679 P B 0.1642
680 C B 0.3158
681 P B -0.4765
682 A B -0.5503
683 P B -0.6741
684 E B -0.8225
685 L B 1.3872
686 L B 1.4466
687 G B 0.4789
688 G B -0.0667
689 P B 0.0000
690 S B -0.0317
691 V B 0.0000
692 F B 1.0037
693 L B 0.6856
694 F B 0.9158
695 P B -0.2891
696 P B 0.0000
697 K B -2.2339
698 P B -1.3291
699 K B -1.1334
700 D B -1.2879
701 T B 0.0000
702 L B -0.3094
703 M B 0.5477
704 I B 1.4890
705 S B 0.0419
706 R B -1.3657
707 T B -0.7275
708 P B 0.0000
709 E B -1.0049
710 V B 0.0000
711 T B 0.1761
712 C B 0.0000
713 V B 0.0000
714 V B 0.0000
715 V B -0.8461
716 D B -2.1094
717 V B 0.0000
718 S B -1.1693
719 H B -1.3549
720 E B -1.1007
721 D B 0.0000
722 P B -1.7855
723 E B -2.4083
724 V B -1.6497
725 K B -2.0167
726 F B -1.1485
727 N B -1.2865
728 W B 0.0000
729 Y B -0.9623
730 V B -1.0782
731 D B -2.1355
732 G B -1.0098
733 V B 0.3709
734 E B -1.4125
735 V B -0.8549
736 H B -2.0216
737 N B -2.2487
738 A B -1.7297
739 K B -2.4767
740 T B -1.8973
741 K B -2.5373
742 P B -2.4600
743 R B -3.5343
744 E B -3.8200
745 E B -3.6611
746 Q B -2.3744
747 Y B -0.3734
748 N B -1.4107
749 S B -1.3209
750 T B -2.0885
751 Y B -2.7174
752 R B -2.6516
753 V B 0.0000
754 V B 0.0000
755 S B 0.0000
756 V B 0.0000
757 L B 0.0000
758 T B -0.6080
759 V B 0.0000
760 L B 0.3543
761 H B -0.2889
762 Q B -1.4379
763 D B -1.4110
764 W B 0.0000
765 L B -0.9745
766 N B -2.1648
767 G B -2.1782
768 K B -2.3515
769 E B -2.5253
770 Y B 0.0000
771 K B -1.9087
772 C B 0.0000
773 K B -1.6741
774 V B 0.0000
775 S B -1.2283
776 N B 0.0000
777 K B -1.5655
778 A B 0.0000
779 L B 0.0000
780 P B -0.3321
781 A B -0.5440
782 P B -0.7991
783 I B -0.8699
784 E B -2.1991
785 K B -1.4455
786 T B -1.1800
787 I B -0.3582
788 S B -1.1460
789 K B -1.3129
790 A B -1.1893
791 K B -2.3698
792 G B -2.1238
793 Q B -2.3773
794 P B -2.2108
795 R B -2.7485
796 E B -2.5405
797 P B 0.0000
798 Q B -1.1586
799 V B 0.0000
800 Y B 0.0000
801 T B 0.0000
802 L B 0.0000
803 P B -0.1844
804 P B 0.0000
805 S B -1.0833
806 R B -1.8254
807 D B -2.3511
808 E B 0.0000
809 L B -1.5309
810 T B -1.4691
811 K B -2.3095
812 N B -2.7003
813 Q B -2.6236
814 V B 0.0000
815 S B 0.0000
816 L B 0.0000
817 T B 0.0000
818 C B 0.0000
819 L B 0.0000
820 V B 0.0000
821 K B 0.0000
822 G B -1.0895
823 F B 0.0000
824 Y B -1.3313
825 P B 0.0000
826 S B -0.2978
827 D B -0.9871
828 I B -0.4704
829 A B -0.4453
830 V B -0.5080
831 E B -1.3934
832 W B 0.0000
833 E B -1.8945
834 S B 0.0000
835 N B -1.9466
836 G B -1.9062
837 Q B -2.3551
838 P B -2.0689
839 E B -2.0563
840 N B -2.2803
841 N B -1.7987
842 Y B -1.1622
843 K B -0.9826
844 T B -0.3596
845 T B 0.0000
846 P B -0.1887
847 P B 0.0662
848 V B 0.3324
849 L B 0.4006
850 D B -0.7536
851 S B -1.3233
852 D B -1.9820
853 G B -1.0283
854 S B 0.0000
855 F B -0.0554
856 F B 0.0000
857 L B 0.0000
858 Y B 0.0000
859 S B 0.0000
860 K B 0.0000
861 L B 0.0000
862 T B -1.1126
863 V B 0.0000
864 D B -2.8095
865 K B -3.0107
866 S B -2.5238
867 R B -2.3151
868 W B 0.0000
869 Q B -2.5140
870 Q B -2.2753
871 G B -1.2849
872 N B -0.9554
873 V B 0.2044
874 F B 0.0000
875 S B 0.0000
876 C B 0.0000
877 S B 0.0000
878 V B 0.0000
879 M B -0.3788
880 H B 0.0000
881 E B -1.1442
882 A B -1.6931
883 L B 0.0000
884 H B -1.8314
885 N B -1.7650
886 H B -1.2131
887 Y B -0.3337
888 T B -0.7537
889 Q B -1.3276
890 K B -1.0571
891 S B -0.4733
892 L B 0.0000
893 S B -0.1557
894 L B -0.3809
895 S B -0.3570
896 P B -0.7120
897 G B -1.2516
898 K B -2.2047
899 D C -1.9750
900 I C -1.2618
901 Q C -1.7530
902 L C 0.0000
903 T C -0.9001
904 Q C 0.0000
905 S C -0.5630
906 P C -0.4318
907 S C -0.6794
908 S C -0.4645
909 L C -0.2881
910 S C -0.7635
911 A C 0.0000
912 S C -0.9477
913 V C 0.0111
914 G C -0.9382
915 D C -1.9010
916 R C -2.4457
917 V C 0.0000
918 T C -0.6458
919 I C 0.0000
920 T C -0.4740
921 C C 0.0000
922 S C -0.9749
923 V C 0.0000
924 S C -1.0645
925 S C -0.9055
926 S C -0.7489
927 I C 0.0000
928 S C -0.7086
929 S C -0.7481
930 N C -0.9075
931 N C -0.4247
932 L C 0.0000
933 H C 0.0000
934 W C 0.0000
935 Y C 0.0000
936 Q C -0.6605
937 Q C -1.0872
938 K C -1.5907
939 P C -1.5275
940 G C -1.6305
941 K C -2.3163
942 A C 0.0000
943 P C 0.0000
944 K C -0.8524
945 P C -0.2006
946 W C 0.0000
947 I C 0.0000
948 Y C 0.3966
949 G C -0.2024
950 T C 0.0000
951 S C -0.4836
952 N C -0.3147
953 L C 0.1372
954 A C -0.0678
955 S C -0.3437
956 G C -0.4887
957 V C -0.2486
958 P C -0.2896
959 S C -0.3483
960 R C -0.7030
961 F C 0.0000
962 S C -0.2657
963 G C 0.0000
964 S C -0.7420
965 G C -1.0287
966 S C -1.1090
967 G C -0.9903
968 T C -1.0419
969 D C -1.6130
970 Y C 0.0000
971 T C -0.5737
972 F C 0.0000
973 T C -0.5856
974 I C 0.0000
975 S C -1.3246
976 S C -1.3208
977 L C 0.0000
978 Q C -1.2887
979 P C -0.9669
980 E C -1.9182
981 D C 0.0000
982 I C -0.3072
983 A C 0.0000
984 T C -0.4991
985 Y C 0.0000
986 Y C 0.0000
987 C C 0.0000
988 Q C 0.0000
989 Q C 0.0000
990 W C 0.3352
991 S C 0.1865
992 S C 0.2852
993 Y C 0.7668
994 P C 0.1243
995 Y C 0.1853
996 M C 0.0000
997 Y C 0.0000
998 T C -0.8111
999 F C 0.0000
1000 G C 0.0000
1001 Q C -1.8178
1002 G C 0.0000
1003 T C 0.0000
1004 K C -0.6100
1005 V C 0.0000
1006 E C 0.0000
1007 I C -0.7670
1008 K C -1.8927
1009 R C -2.3317
1010 T C -0.4743
1011 V C 0.6452
1012 A C 0.2944
1013 A C 0.0278
1014 P C 0.0000
1015 S C -0.1489
1016 V C 0.0000
1017 F C -0.0367
1018 I C -0.0193
1019 F C 0.0000
1020 P C -0.6930
1021 P C -0.9465
1022 S C -1.6704
1023 D C -2.9732
1024 E C -2.9260
1025 Q C 0.0000
1026 L C -1.9761
1027 K C -2.6547
1028 S C -1.4182
1029 G C -0.9969
1030 T C -0.6767
1031 A C 0.0000
1032 S C 0.0000
1033 V C 0.0000
1034 V C 0.0000
1035 C C 0.0000
1036 L C 0.0000
1037 L C 0.0000
1038 N C -0.3062
1039 N C -0.9013
1040 F C 0.0000
1041 Y C 0.0000
1042 P C -1.7989
1043 R C -3.0176
1044 E C -3.2611
1045 A C -2.3539
1046 K C -2.4324
1047 V C -1.0699
1048 Q C -0.6563
1049 W C 0.0000
1050 K C -0.6014
1051 V C 0.0000
1052 D C -2.1284
1053 N C -1.6189
1054 A C -0.3581
1055 L C 0.6605
1056 Q C -0.2064
1057 S C -0.4781
1058 G C -0.8909
1059 N C -0.7614
1060 S C -1.1828
1061 Q C -1.6623
1062 E C -2.0453
1063 S C -0.8827
1064 V C -0.7549
1065 T C -1.1142
1066 E C -2.1596
1067 Q C -1.8281
1068 D C -1.9217
1069 S C -1.7991
1070 K C -2.5024
1071 D C -2.4819
1072 S C 0.0000
1073 T C 0.0000
1074 Y C 0.0000
1075 S C 0.0000
1076 L C 0.0000
1077 S C 0.0000
1078 S C 0.0000
1079 T C -0.7355
1080 L C 0.0000
1081 T C -0.3239
1082 L C -0.3683
1083 S C -0.9212
1084 K C -1.7185
1085 A C -1.5605
1086 D C -2.0151
1087 Y C 0.0000
1088 E C -3.3406
1089 K C -3.4912
1090 H C -3.1709
1091 K C -3.3692
1092 V C -1.4184
1093 Y C 0.0000
1094 A C -0.5919
1095 C C 0.0000
1096 E C -0.6313
1097 V C 0.0000
1098 T C -1.1558
1099 H C 0.0000
1100 Q C -1.7065
1101 G C -0.3655
1102 L C -0.2476
1103 S C -0.4946
1104 S C -0.4345
1105 P C -0.5919
1106 V C 0.0911
1107 T C -0.3344
1108 K C -0.7603
1109 S C -0.3288
1110 F C -0.9104
1111 N C -1.8836
1112 R C -3.0362
1113 G C -2.6753
1114 E C -2.4232
1115 C C -1.2574
1116 D D -2.0449
1117 I D -1.3758
1118 Q D -1.7668
1119 L D 0.0000
1120 T D -0.9166
1121 Q D 0.0000
1122 S D -0.6390
1123 P D -0.5473
1124 S D -0.7856
1125 S D -0.5903
1126 L D -0.2942
1127 S D -0.5147
1128 A D 0.0000
1129 S D -0.7101
1130 V D -0.4219
1131 G D -1.1162
1132 D D -1.9684
1133 R D -2.4072
1134 V D 0.0000
1135 T D -0.6609
1136 I D 0.0000
1137 T D -0.6095
1138 C D 0.0000
1139 S D -1.1358
1140 V D 0.0000
1141 S D -1.1736
1142 S D -1.0471
1143 S D -0.8780
1144 I D 0.0000
1145 S D -0.6647
1146 S D -0.6151
1147 N D -0.8776
1148 N D 0.0000
1149 L D 0.0000
1150 H D 0.0000
1151 W D 0.0000
1152 Y D 0.0000
1153 Q D -1.2593
1154 Q D -1.9159
1155 K D -2.8871
1156 P D -2.1779
1157 G D -1.9370
1158 K D -2.8656
1159 A D -1.7265
1160 P D -1.6121
1161 K D -1.7684
1162 P D -0.5469
1163 W D 0.0000
1164 I D 0.0000
1165 Y D -0.0101
1166 G D -0.3023
1167 T D 0.0000
1168 S D -0.5492
1169 N D -0.4422
1170 L D 0.3679
1171 A D 0.0000
1172 S D -0.3031
1173 G D -0.4605
1174 V D 0.0000
1175 P D -0.3284
1176 S D -0.3742
1177 R D -0.7633
1178 F D 0.0000
1179 S D -0.3946
1180 G D -0.3267
1181 S D -0.8351
1182 G D -1.2121
1183 S D -1.2595
1184 G D -1.1893
1185 T D -1.3823
1186 D D -2.1590
1187 Y D 0.0000
1188 T D -0.7092
1189 F D 0.0000
1190 T D -0.6124
1191 I D 0.0000
1192 S D -1.3253
1193 S D -1.2996
1194 L D 0.0000
1195 Q D -1.0381
1196 P D -1.0066
1197 E D -1.9903
1198 D D 0.0000
1199 I D -0.3662
1200 A D 0.0000
1201 T D -0.9213
1202 Y D 0.0000
1203 Y D 0.0000
1204 C D 0.0000
1205 Q D 0.0000
1206 Q D -0.2451
1207 W D 0.0000
1208 S D -0.0723
1209 S D 0.0947
1210 Y D 0.4044
1211 P D -0.1547
1212 Y D 0.0000
1213 M D 0.0000
1214 Y D 0.0000
1215 T D -0.6879
1216 F D -0.4479
1217 G D 0.0000
1218 Q D -1.8376
1219 G D -0.9984
1220 T D 0.0000
1221 K D -0.9203
1222 V D 0.0000
1223 E D 0.0000
1224 I D -0.2886
1225 K D -0.7278
1226 R D 0.0000
1227 T D 0.0089
1228 V D 0.5716
1229 A D 0.2537
1230 A D 0.2178
1231 P D 0.0000
1232 S D -0.2737
1233 V D 0.0000
1234 F D -0.0577
1235 I D -0.0482
1236 F D 0.0000
1237 P D -0.8979
1238 P D 0.0000
1239 S D -1.7851
1240 D D -3.2002
1241 E D -3.3190
1242 Q D -2.3520
1243 L D -2.4593
1244 K D -2.9397
1245 S D -1.9231
1246 G D -1.2769
1247 T D -0.9882
1248 A D 0.0000
1249 S D 0.0000
1250 V D 0.0000
1251 V D 0.0000
1252 C D 0.0000
1253 L D 0.0000
1254 L D 0.0000
1255 N D 0.0000
1256 N D -0.9989
1257 F D 0.0000
1258 Y D 0.0000
1259 P D -1.4870
1260 R D -2.6336
1261 E D -2.9976
1262 A D -2.1688
1263 K D -2.1701
1264 V D -0.9483
1265 Q D -0.5314
1266 W D 0.0000
1267 K D -0.7164
1268 V D 0.0000
1269 D D -1.9961
1270 N D -1.5421
1271 A D -0.2659
1272 L D 0.7821
1273 Q D -0.2796
1274 S D -0.5950
1275 G D -1.0023
1276 N D -0.9462
1277 S D -1.4144
1278 Q D -1.9770
1279 E D -2.3874
1280 S D -1.1648
1281 V D -0.9963
1282 T D -1.1766
1283 E D -2.2424
1284 Q D -1.8542
1285 D D -1.9739
1286 S D -1.9033
1287 K D -2.2632
1288 D D -1.6765
1289 S D 0.0000
1290 T D 0.0000
1291 Y D 0.0000
1292 S D 0.0000
1293 L D 0.0000
1294 S D 0.0000
1295 S D 0.0000
1296 T D 0.0000
1297 L D 0.0000
1298 T D -0.3638
1299 L D -0.2663
1300 S D -1.2064
1301 K D -2.1261
1302 A D -1.6146
1303 D D -2.3023
1304 Y D 0.0000
1305 E D -3.7000
1306 K D -3.6407
1307 H D -3.4039
1308 K D -3.4054
1309 V D -2.1789
1310 Y D 0.0000
1311 A D -0.8825
1312 C D 0.0000
1313 E D -0.8775
1314 V D 0.0000
1315 T D -1.1196
1316 H D 0.0000
1317 Q D -1.6809
1318 G D -0.3964
1319 L D -0.0307
1320 S D -0.4765
1321 S D -0.6626
1322 P D -0.5248
1323 V D -0.1896
1324 T D -0.6439
1325 K D -0.9534
1326 S D -0.9654
1327 F D -1.2149
1328 N D -2.3737
1329 R D -2.8552
1330 G D -2.4080
1331 E D -2.2687
1332 C D -0.9557

 

Laboratory of Theory of Biopolymers 2015