Project name: 4x34_B

Status: done

submitted: 2018-05-30 11:41:46, status changed: 2018-05-30 11:48:55
Settings
Chain sequence(s) B: NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0058
Maximal score value
1.6916
Average score
-1.0775
Total score value
-128.2189

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1484 N B -1.0832
1485 S B -0.6476
1486 F B 0.0770
1487 V B -0.2601
1488 G B -0.4572
1489 L B 0.0795
1490 R B -0.8471
1491 V B 0.0000
1492 V B 0.0000
1493 A B 0.0000
1494 K B -0.3655
1495 W B -0.2494
1496 S B -0.5152
1497 S B -0.8508
1498 N B -1.2333
1499 G B 0.0000
1500 Y B -0.2380
1501 F B 0.0000
1502 Y B 0.0022
1503 S B 0.0000
1504 G B 0.0000
1505 K B -1.3651
1506 I B 0.0000
1507 T B -1.4333
1508 R B -2.5226
1509 D B -2.2212
1510 V B -1.0130
1511 G B -0.7574
1512 A B -0.3150
1513 G B -0.7379
1514 K B -1.3393
1515 Y B -1.3170
1516 K B -1.9858
1517 L B 0.0000
1518 L B -1.5075
1519 F B 0.0000
1520 D B -1.5849
1521 D B -2.0960
1522 G B -1.5354
1523 Y B -0.9220
1524 E B -2.0903
1525 C B -1.0495
1526 D B -1.5872
1527 V B 0.0000
1528 L B -0.4434
1529 G B 0.0000
1530 K B -1.8337
1531 D B -0.9290
1532 I B 0.0000
1533 L B 0.0000
1534 L B -0.0143
1535 C B 0.0000
1536 D B -1.4247
1537 P B -1.0985
1538 I B 0.0000
1539 P B -0.6719
1540 L B -0.4618
1541 D B -1.9881
1542 T B -1.7380
1543 E B -2.5707
1544 V B 0.0000
1545 T B 0.0000
1546 A B 0.0000
1547 L B -0.0216
1548 S B -1.3855
1549 E B -2.7631
1550 D B -2.8853
1551 E B -2.0584
1552 Y B 0.4819
1553 F B 1.6916
1554 S B 1.1231
1555 A B -0.2336
1556 G B -1.4657
1557 V B -1.7123
1558 V B 0.0000
1559 K B -1.8034
1560 G B -1.3265
1561 H B -1.6469
1562 R B -3.4093
1563 K B -4.0058
1564 E B -3.5137
1565 S B -1.9351
1566 G B -2.1602
1567 E B -2.6231
1568 L B 0.0000
1569 Y B -1.8157
1570 Y B 0.0000
1571 S B 0.0000
1572 I B 0.0000
1573 E B -2.9527
1574 K B -2.3977
1575 E B -2.8284
1576 G B -2.4737
1577 Q B -3.3438
1578 R B -3.6522
1579 K B -2.4308
1580 W B -1.1842
1581 Y B 0.0000
1582 K B -1.4273
1583 R B -0.5976
1584 M B -0.3736
1585 A B 0.0000
1586 V B 0.0000
1587 I B 0.0000
1588 L B 0.0000
1589 S B -0.6937
1590 L B -0.8060
1591 E B -2.3875
1592 Q B 0.0000
1593 G B 0.0000
1594 N B -2.7865
1595 R B -3.4167
1596 L B -2.3027
1597 R B -2.8025
1598 E B -3.1955
1599 Q B -2.3463
1600 Y B -1.4015
1601 G B -1.4887
1602 L B -0.3175

 

Laboratory of Theory of Biopolymers 2015