Project name: o156 [mutate: GA40K, VA224K]

Status: done

submitted: 2018-01-12 16:16:57, status changed: 2018-01-12 16:34:58
Settings
Chain sequence(s) A: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues GA40K, VA224K
Energy difference between WT (input) and mutated protein (by FoldX) 6.65403 kcal/mol
Show buried residues

Minimal score value
-3.9447
Maximal score value
1.3202
Average score
-0.9503
Total score value
-213.8253

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 K A -2.6640
4 G A 0.0000
5 E A -3.1121
6 E A -2.9169
7 L A -1.2566
8 F A 0.0000
9 T A -0.4702
10 G A 0.4759
11 V A 1.3202
12 V A 0.0000
13 P A -0.8680
14 I A 0.0000
15 L A -1.0458
16 V A 0.0000
17 E A -2.0457
18 L A 0.0000
19 D A -3.4683
20 G A 0.0000
21 D A -2.8931
22 V A 0.0000
23 N A -2.1966
24 G A -1.7698
25 H A -2.1531
26 K A -3.0060
27 F A 0.0000
28 S A -1.8172
29 V A 0.0000
30 S A -1.0389
31 G A 0.0000
32 E A -2.0936
33 G A -1.4119
34 E A -1.3975
35 G A 0.0000
36 D A 0.0513
37 A A 0.0000
38 T A 0.2379
39 Y A 0.7904
40 K A -0.4121 mutated: GA40K
41 K A -0.5161
42 L A 0.0000
43 T A -0.6096
44 L A 0.0000
45 K A -0.9165
46 F A 0.0000
47 I A -1.0952
48 C A 0.0000
49 T A -0.9711
50 T A -1.3455
51 G A -1.6857
52 K A -2.2865
53 L A 0.0000
54 P A -1.2256
55 V A 0.0000
56 P A 0.0000
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0117
63 T A 0.0000
64 L A 0.0000
68 V A 0.0000
69 Q A 0.0000
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -1.0990
74 Y A -1.4349
75 P A -1.8864
76 D A -2.9946
77 H A -2.4340
78 M A 0.0000
79 K A -3.1754
80 Q A -2.4022
81 H A -1.5879
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -1.3862
87 A A 0.0000
88 M A 0.0000
89 P A -1.7753
90 E A -2.3522
91 G A 0.0000
92 Y A 0.0000
93 V A 0.0000
94 Q A 0.0000
95 E A -1.8322
96 R A 0.0000
97 T A -0.3190
98 I A 0.0000
99 F A 0.3169
100 F A 0.0000
101 K A -1.7917
102 D A -2.8406
103 D A -2.4411
104 G A 0.0000
105 N A -0.7892
106 Y A 0.0000
107 K A -1.7995
108 T A 0.0000
109 R A -2.8298
110 A A 0.0000
111 E A -2.1476
112 V A 0.0000
113 K A -1.6715
114 F A -1.8104
115 E A -2.5896
116 G A -2.1723
117 D A -2.3731
118 T A -1.6648
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -2.9853
123 I A 0.0000
124 E A -3.9447
125 L A 0.0000
126 K A -2.8545
127 G A 0.0000
128 I A -1.2594
129 D A -2.5194
130 F A 0.0000
131 K A -3.9338
132 E A -3.9318
133 D A -3.4791
134 G A -2.7284
135 N A -2.0653
136 I A 0.0000
137 L A -1.8587
138 G A -2.0814
139 H A -1.7625
140 K A -2.1573
141 L A -1.4689
142 E A -1.5412
143 Y A -0.4851
144 N A -0.5343
145 Y A -0.8393
146 N A -1.2847
147 S A -1.2871
148 H A 0.0000
149 N A -1.1840
150 V A 0.0000
151 Y A 0.5119
152 I A 0.0000
153 M A -0.7833
154 A A -1.5371
155 D A 0.0000
156 K A -3.0633
157 Q A -2.9691
158 K A -3.0228
159 N A -2.8500
160 G A 0.0000
161 I A 0.0000
162 K A -1.0300
163 V A 0.0000
164 N A -0.2795
165 F A 0.0000
166 K A -1.8434
167 I A 0.0000
168 R A -1.6912
169 H A 0.0000
170 N A -1.4810
171 I A 0.0000
172 E A -3.1813
173 D A -3.0091
174 G A -1.9075
175 S A -1.0378
176 V A -0.3758
177 Q A 0.0000
178 L A -1.0149
179 A A 0.0000
180 D A 0.0000
181 H A 0.0000
182 Y A 0.6012
183 Q A 0.0000
184 Q A -0.8606
185 N A 0.0000
186 T A -1.0795
187 P A -0.9632
188 I A -0.4408
189 G A -1.3668
190 D A -2.2584
191 G A -1.5947
192 P A -0.7755
193 V A -0.3124
194 L A -0.2078
195 L A -0.5562
196 P A 0.0000
197 D A -2.3144
198 N A -1.7750
199 H A 0.0000
200 Y A -0.0006
201 L A 0.0000
202 S A -0.6351
203 T A 0.0000
204 Q A -1.3761
205 S A -0.5332
206 A A 0.0320
207 L A 0.0380
208 S A -0.6891
209 K A -1.9689
210 D A -2.1525
211 P A -1.8518
212 N A -2.4864
213 E A -2.7293
214 K A -3.3098
215 R A -3.3839
216 D A -2.2757
217 H A 0.0000
218 M A 0.0000
219 V A -0.2723
220 L A 0.0000
221 L A 0.5009
222 E A 0.0000
223 F A -0.2378
224 K A -0.7090 mutated: VA224K
225 T A -0.5077
226 A A 0.0000
227 A A -0.3572
228 G A -0.4859
229 I A -0.4847
230 T A -0.1849

 

Laboratory of Theory of Biopolymers 2015