Project name: d5431389a02a57c

Status: done

submitted: 2019-01-11 19:22:34, status changed: 2019-01-11 19:28:37
Settings
Chain sequence(s) A: GSSGSSGLHRIVDKMHDTSTGIRPSPNMEQGSTYKKTFLGSSLVDWLISSNFAASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKVSSKESGPSSG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5352
Maximal score value
0.1848
Average score
-1.1135
Total score value
-133.6201

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.6838
2 S A -0.6701
3 S A -0.8951
4 G A -0.9619
5 S A -1.0496
6 S A -1.1477
7 G A -1.2228
8 L A 0.0000
9 H A -2.5662
10 R A -3.1853
11 I A 0.0000
12 V A -2.2515
13 D A -3.5352
14 K A -2.9225
15 M A 0.0000
16 H A -2.7154
17 D A -2.5250
18 T A -1.5778
19 S A -1.1056
20 T A -1.0513
21 G A -1.8709
22 I A 0.0000
23 R A -2.4740
24 P A -1.9363
25 S A -1.6532
26 P A -1.1587
27 N A -1.0451
28 M A -0.1595
29 E A -0.8732
30 Q A -1.2817
31 G A -0.9259
32 S A -0.7777
33 T A -0.8833
34 Y A -1.1799
35 K A -2.5070
36 K A -2.8570
37 T A 0.0000
38 F A 0.0000
39 L A -0.7726
40 G A 0.0000
41 S A -1.3044
42 S A -1.1599
43 L A 0.0000
44 V A 0.0000
45 D A -2.3750
46 W A 0.0000
47 L A 0.0000
48 I A -1.0124
49 S A -0.8773
50 S A -0.8229
51 N A -1.1230
52 F A -0.5897
53 A A -0.8027
54 A A -0.7513
55 S A -1.1616
56 R A -1.9276
57 L A -0.1886
58 E A -0.8992
59 A A 0.0000
60 V A -0.6483
61 T A -0.4885
62 L A -0.2251
63 A A 0.0000
64 S A 0.0000
65 M A -0.4665
66 L A 0.0000
67 M A -0.9226
68 E A -2.0055
69 E A -1.3726
70 N A -2.1162
71 F A -1.3472
72 L A 0.0000
73 R A -1.3942
74 P A 0.0000
75 V A -0.0859
76 G A -0.2130
77 V A -0.2572
78 R A -1.3278
79 S A 0.0000
80 M A 0.1848
81 G A -0.2660
82 A A -0.3296
83 I A -0.7499
84 R A -2.4366
85 S A -2.1276
86 G A -1.8872
87 D A -2.3651
88 L A -1.0494
89 A A -1.5955
90 E A -1.9180
91 Q A -1.3714
92 F A 0.0000
93 L A -0.1091
94 D A -1.0450
95 D A -1.7828
96 S A -1.0106
97 T A -0.9144
98 A A 0.0000
99 L A 0.0000
100 Y A 0.0000
101 T A -0.9203
102 F A -0.8315
103 A A -1.5939
104 E A -2.5825
105 S A -1.8503
106 Y A -2.1238
107 K A -3.0369
108 K A -3.2012
109 K A -2.1307
110 V A -0.3357
111 S A -0.9095
112 S A -1.5213
113 K A -2.6415
114 E A -2.8137
115 S A -1.8269
116 G A -1.3822
117 P A -0.9108
118 S A -0.6720
119 S A -0.6567
120 G A -0.6163

 

Laboratory of Theory of Biopolymers 2015