Project name: 4AOW

Status: done

submitted: 2018-01-12 16:20:01, status changed: 2018-01-12 16:42:06
Settings
Chain sequence(s) A: EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
C: EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
B: EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7989
Maximal score value
1.9161
Average score
-0.6106
Total score value
-556.2641

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 E A -1.4431
4 Q A -1.2639
5 M A 0.0000
6 T A -0.3357
7 L A -0.2672
8 R A -1.7290
9 G A -1.6139
10 T A -0.7431
11 L A 0.0000
12 K A -2.1398
13 G A -1.3895
14 H A 0.0000
15 N A -2.0191
16 G A -1.1806
17 W A -0.4169
18 V A 0.0000
19 T A -0.1564
20 Q A -0.1382
21 I A 0.0000
22 A A 0.0000
23 T A -0.0554
24 T A 0.0000
25 P A -1.1551
26 Q A -1.4108
27 F A -0.1644
28 P A -0.8580
29 D A -1.4185
30 M A 0.0000
31 I A 0.0000
32 L A 0.0000
33 S A 0.0000
34 A A 0.0000
35 S A 0.0000
36 R A -1.1501
37 D A -1.7445
38 K A -2.0060
39 T A 0.0000
40 I A 0.0000
41 I A 0.0000
42 M A 0.0000
43 W A 0.0000
44 K A -1.9244
45 L A 0.0000
46 T A -1.8774
47 R A -3.0326
48 D A -3.2665
49 E A -3.0444
50 T A -2.0493
51 N A -2.4954
52 Y A 0.0000
53 G A 0.0000
54 I A -0.9831
55 P A -1.4594
56 Q A -1.9623
57 R A -2.5882
58 A A -1.7255
59 L A 0.0000
60 R A -2.4694
61 G A -1.6300
62 H A 0.0000
63 S A -1.0567
64 H A -1.0069
65 F A -0.6487
66 V A 0.0000
67 S A -0.2382
68 D A 0.0000
69 V A 0.0000
70 V A 0.4356
71 I A -0.0734
72 S A 0.0000
73 S A -1.6342
74 D A -2.1240
75 G A -1.3555
76 Q A -1.5896
77 F A -0.5210
78 A A 0.0000
79 L A 0.0000
80 S A 0.0000
81 G A 0.0000
82 S A 0.0000
83 W A -0.7119
84 D A -0.9439
85 G A 0.0000
86 T A 0.0000
87 L A 0.0000
88 R A -1.1766
89 L A 0.0000
90 W A 0.0000
91 D A -0.7250
92 L A 0.0000
93 T A -0.6284
94 T A -0.5954
95 G A -0.8794
96 T A -0.7068
97 T A -1.2206
98 T A -0.8942
99 R A -1.6213
100 R A -1.6520
101 F A 0.0000
102 V A 1.2765
103 G A 0.5188
104 H A 0.0000
105 T A -1.0591
106 K A -2.2355
107 D A -1.2082
108 V A 0.0000
109 L A -0.1242
110 S A 0.0000
111 V A 0.0000
112 A A 0.0000
113 F A -0.6038
114 S A 0.0000
115 S A -1.5601
116 D A -2.6448
117 N A -2.2794
118 R A -2.5486
119 Q A -1.6084
120 I A 0.0000
121 V A 0.0000
122 S A 0.0000
123 G A 0.0000
124 S A 0.0000
125 R A -1.3768
126 D A -1.8242
127 K A -2.1583
128 T A 0.0000
129 I A 0.0000
130 K A -0.4112
131 L A 0.0000
132 W A 0.0000
133 N A -0.1297
134 T A 0.0254
135 L A 1.2439
136 G A 0.8495
137 V A 1.9161
138 C A 0.7971
139 K A -0.8785
140 Y A -0.1828
141 T A -0.6184
142 V A 0.0000
143 Q A -2.5572
144 D A -3.2291
145 E A -2.6014
146 S A 0.0000
147 H A 0.0000
148 S A -1.4969
149 E A -1.3055
150 W A -0.8477
151 V A 0.0000
152 S A 0.0000
153 C A 0.0397
154 V A 0.0000
155 R A -0.1178
156 F A -0.0019
157 S A -0.5300
158 P A -1.1801
159 N A -1.3277
160 S A -0.6628
161 S A -0.7030
162 N A -0.7857
163 P A -0.5189
164 I A 0.0000
165 I A 0.0000
166 V A 0.0000
167 S A 0.0000
168 C A 0.0000
169 G A 0.0000
170 W A -0.4980
171 D A -0.6215
172 K A -0.7237
173 L A 0.0855
174 V A 0.0000
175 K A 0.0000
176 V A 0.0000
177 W A 0.0000
178 N A -1.4916
179 L A -0.6944
180 A A -0.8198
181 N A -1.6933
182 C A 0.0000
183 K A -2.8276
184 L A -2.1821
185 K A -2.0594
186 T A -1.2964
187 N A -0.7756
188 H A 0.0000
189 I A 1.3980
190 G A 0.0000
191 H A 0.0000
192 T A -0.8278
193 G A -0.8628
194 Y A -0.6534
195 L A 0.0000
196 N A -0.4442
197 T A 0.0000
198 V A 0.0000
199 T A 0.0848
200 V A -0.2054
201 S A 0.0000
202 P A -1.2262
203 D A -2.0206
204 G A 0.0000
205 S A -1.3608
206 L A -0.5538
207 C A 0.0000
208 A A 0.0000
209 S A 0.0000
210 G A 0.0000
211 G A 0.0000
212 K A -1.8690
213 D A -1.7743
214 G A 0.0000
215 Q A -1.3948
216 A A 0.0000
217 M A 0.0000
218 L A 0.0000
219 W A 0.0000
220 D A -1.4547
221 L A 0.0000
222 N A -2.5763
223 E A -2.9551
224 G A -2.4089
225 K A -2.3475
226 H A -0.5063
227 L A 0.2571
228 Y A 0.0608
229 T A -0.6349
230 L A 0.0000
231 D A -2.3795
232 G A 0.0000
233 G A -1.5053
234 D A -1.6097
235 I A -0.9105
236 I A 0.0000
237 N A -0.6084
238 A A -0.1146
239 L A 0.0000
240 C A 0.0921
241 F A 0.0000
242 S A 0.0000
243 P A -1.2725
244 N A -1.6841
245 R A -0.5069
246 Y A 0.3349
247 W A 0.0000
248 L A 0.0000
249 C A 0.0000
250 A A 0.0000
251 A A 0.0000
252 T A 0.0000
253 G A 0.0000
254 P A -1.1304
255 S A 0.0000
256 I A 0.0000
257 K A -0.4858
258 I A 0.0000
259 W A 0.0000
260 D A -0.1786
261 L A 0.0000
262 E A -1.8434
263 G A -1.0631
264 K A -0.5326
265 I A 1.2834
266 I A 1.2794
267 V A 0.2601
268 D A -0.5761
269 E A -0.9994
270 L A 0.0000
271 K A -2.6030
272 Q A -2.2479
273 E A -2.6156
281 A A -0.8675
282 E A -1.9473
283 P A -1.7571
284 P A -1.1691
285 Q A -0.9711
286 C A 0.0000
287 T A -0.1362
288 S A 0.0000
289 L A 0.0000
290 A A -0.0318
291 W A 0.0000
292 S A -0.8021
293 A A -1.3434
294 D A -2.2681
295 G A 0.0000
296 Q A -1.3556
297 T A 0.0000
298 L A 0.0000
299 F A 0.0000
300 A A 0.0000
301 G A 0.0000
302 Y A 0.0000
303 T A -0.4335
304 D A -1.1731
305 N A -1.2703
306 L A -0.8855
307 V A 0.0000
308 R A 0.0000
309 V A 0.0000
310 W A 0.0000
311 Q A -0.7869
312 V A 0.0000
313 T A -0.0650
314 I A 0.9829
3 E B -1.2832
4 Q B -1.2753
5 M B 0.0000
6 T B -0.5950
7 L B -0.5814
8 R B -1.9052
9 G B -1.8269
10 T B -0.9079
11 L B 0.0000
12 K B -2.0711
13 G B -1.3316
14 H B 0.0000
15 N B -1.9424
16 G B -1.3498
17 W B -0.4670
18 V B 0.0000
19 T B -0.1876
20 Q B -0.1839
21 I B 0.0000
22 A B 0.0000
23 T B -0.2031
24 T B 0.0000
25 P B -1.3123
26 Q B -1.5536
27 F B -0.7798
28 P B -1.4473
29 D B -2.3367
30 M B -1.2588
31 I B 0.0000
32 L B 0.0000
33 S B 0.0000
34 A B 0.0000
35 S B 0.0000
36 R B -1.1565
37 D B -1.7305
38 K B -1.7755
39 T B 0.0000
40 I B 0.0000
41 I B 0.0000
42 M B 0.0000
43 W B 0.0000
44 K B -2.3444
45 L B -2.0329
46 T B -2.2926
47 R B -3.7989
48 D B -3.7803
49 E B -3.2547
50 T B -2.1760
51 N B -2.3625
52 Y B 0.0000
53 G B 0.0000
54 I B -0.8894
55 P B -1.4734
56 Q B -2.2110
57 R B -2.5216
58 A B -1.6736
59 L B 0.0000
60 R B -2.4247
61 G B -1.6181
62 H B 0.0000
63 S B -0.8178
64 H B 0.0000
65 F B 0.0000
66 V B 0.0000
67 S B -0.2162
68 D B 0.0000
69 V B 0.0000
70 V B 0.4039
71 I B -0.0042
72 S B 0.0000
73 S B -1.4645
74 D B -1.8353
75 G B 0.0000
76 Q B -1.3630
77 F B -0.3565
78 A B 0.0000
79 L B 0.0000
80 S B 0.0000
81 G B 0.0000
82 S B 0.0000
83 W B -0.2932
84 D B -0.6493
85 G B 0.0000
86 T B 0.0000
87 L B 0.0000
88 R B -1.1620
89 L B 0.0000
90 W B 0.0000
91 D B -0.6235
92 L B 0.0000
93 T B -0.5478
94 T B -0.5395
95 G B -0.8037
96 T B -0.6811
97 T B -1.1937
98 T B -0.8437
99 R B -1.5377
100 R B -1.6610
101 F B 0.0000
102 V B 1.0912
103 G B 0.4096
104 H B 0.0000
105 T B -0.8799
106 K B -1.2485
107 D B 0.0000
108 V B 0.0000
109 L B 0.0918
110 S B 0.0000
111 V B 0.0000
112 A B 0.0000
113 F B -0.6467
114 S B 0.0000
115 S B -1.5780
116 D B -2.6600
117 N B -2.2762
118 R B -2.5706
119 Q B -1.7130
120 I B 0.0000
121 V B 0.0000
122 S B 0.0000
123 G B 0.0000
124 S B 0.0000
125 R B 0.0000
126 D B -1.0413
127 K B -1.1222
128 T B 0.0000
129 I B 0.0000
130 K B -0.2708
131 L B 0.0000
132 W B 0.0000
133 N B -0.0787
134 T B 0.0406
135 L B 1.2490
136 G B 0.8484
137 V B 1.8133
138 C B 0.7974
139 K B -0.8479
140 Y B -0.0860
141 T B -0.3811
142 V B 0.0000
143 Q B -1.7161
145 E B -2.4485
146 S B -1.6967
147 H B 0.0000
148 S B -1.3644
149 E B -1.1193
150 W B 0.0000
151 V B 0.0000
152 S B 0.0000
153 C B -0.0135
154 V B 0.0000
155 R B -0.1727
156 F B -0.0468
157 S B -0.5585
158 P B -1.1965
159 N B -1.3720
160 S B -0.8654
161 S B -0.7148
162 N B -0.8024
163 P B -0.5442
164 I B 0.0000
165 I B 0.0000
166 V B 0.0000
167 S B 0.0000
168 C B 0.0000
169 G B 0.0000
170 W B -0.7460
171 D B -0.9049
172 K B -1.3907
173 L B 0.0000
174 V B 0.0000
175 K B 0.0000
176 V B 0.0000
177 W B 0.0000
178 N B -1.4792
179 L B -0.7229
180 A B -0.8381
181 N B -1.7165
182 C B 0.0000
183 K B -2.7838
184 L B 0.0000
185 K B -1.8203
186 T B -1.0953
187 N B 0.0000
188 H B 0.0000
189 I B 0.0568
190 G B -0.4170
191 H B 0.0000
192 T B -1.0300
193 G B -1.1161
194 Y B -1.0081
195 L B 0.0000
196 N B -0.5555
197 T B 0.0000
198 V B 0.0000
199 T B 0.0748
200 V B -0.2200
201 S B 0.0000
202 P B -1.2310
203 D B -2.0546
204 G B 0.0000
205 S B -1.3800
206 L B -0.6366
207 C B 0.0000
208 A B 0.0000
209 S B 0.0000
210 G B 0.0000
211 G B 0.0000
212 K B -1.9474
213 D B -1.7805
214 G B 0.0000
215 Q B -1.6961
216 A B 0.0000
217 M B 0.0000
218 L B 0.0000
219 W B 0.0000
220 D B -1.6172
221 L B 0.0000
222 N B -2.5830
223 E B -3.2455
224 G B -2.6314
225 K B -2.7004
226 H B -1.1707
227 L B -0.2000
228 Y B -0.0139
229 T B -0.6197
230 L B 0.0000
231 D B -2.2544
232 G B 0.0000
233 G B -1.5870
234 D B -1.6697
235 I B -0.9894
236 I B 0.0000
237 N B -0.6153
238 A B 0.0000
239 L B 0.0000
240 C B 0.0931
241 F B 0.0000
242 S B 0.0000
243 P B -1.2783
244 N B -1.6919
245 R B -0.4963
246 Y B 0.3495
247 W B 0.0000
248 L B 0.0000
249 C B 0.0000
250 A B 0.0000
251 A B 0.0000
252 T B 0.0000
253 G B 0.0000
254 P B -1.0188
255 S B 0.0000
256 I B 0.0000
257 K B -0.9325
258 I B 0.0000
259 W B 0.0000
260 D B -0.4277
261 L B 0.0000
262 E B -2.0414
263 G B -1.3906
264 K B -1.2733
265 I B 1.0643
266 I B 0.7804
267 V B -0.1331
268 D B -1.0973
269 E B -2.0247
270 L B 0.0000
271 K B -2.6993
272 Q B -1.9971
283 P B -0.8542
284 P B -0.9220
285 Q B -0.8349
286 C B 0.0000
287 T B -0.1709
288 S B 0.0000
289 L B 0.0000
290 A B -0.0400
291 W B 0.0000
292 S B -0.9816
293 A B -1.5333
294 D B -2.3175
295 G B 0.0000
296 Q B -1.4337
297 T B 0.0000
298 L B 0.0000
299 F B 0.0000
300 A B 0.0000
301 G B 0.0000
302 Y B 0.0000
303 T B -0.4763
304 D B -1.2376
305 N B -1.2658
306 L B -0.9087
307 V B 0.0000
308 R B 0.0000
309 V B 0.0000
310 W B 0.0000
311 Q B -0.8487
312 V B -0.4877
313 T B 0.0843
314 I B 1.0678
3 E C -1.5260
4 Q C -1.1949
5 M C 0.0000
6 T C -0.4377
7 L C -0.6187
8 R C -1.8242
9 G C -1.6125
10 T C -0.7516
11 L C 0.0000
12 K C -2.1709
13 G C -1.5228
14 H C 0.0000
15 N C -2.0445
16 G C -1.1961
17 W C -0.4133
18 V C 0.0000
19 T C -0.1579
20 Q C -0.1285
21 I C 0.0000
22 A C 0.0000
23 T C -0.2084
24 T C 0.0000
25 P C -1.3776
26 Q C -1.5662
27 F C -0.6874
28 P C -1.3799
29 D C -2.1673
30 M C -1.1063
31 I C 0.0000
32 L C 0.0000
33 S C 0.0000
34 A C 0.0000
35 S C 0.0000
36 R C -1.1612
37 D C -1.7359
38 K C -1.9765
39 T C 0.0000
40 I C 0.0000
41 I C 0.0000
42 M C -0.9385
43 W C 0.0000
44 K C -1.9139
45 L C 0.0000
46 T C -1.7624
47 R C -2.6661
48 D C -2.9917
49 E C -2.9226
50 T C -1.8734
51 N C -2.1063
52 Y C 0.0000
53 G C 0.0000
54 I C -0.7313
55 P C -1.3205
56 Q C -1.6991
57 R C -2.4537
58 A C -1.6727
59 L C 0.0000
60 R C -2.4590
61 G C -1.6331
62 H C 0.0000
63 S C -1.0625
64 H C -1.0295
65 F C -0.6529
66 V C 0.0000
67 S C -0.2439
68 D C 0.0000
69 V C 0.0000
70 V C 0.3965
71 I C 0.0000
72 S C 0.0000
73 S C -1.5253
74 D C -1.9422
75 G C 0.0000
76 Q C -1.3924
77 F C -0.4171
78 A C 0.0000
79 L C 0.0000
80 S C 0.0000
81 G C 0.0000
82 S C 0.0000
83 W C -0.7295
84 D C -1.0002
85 G C -0.7984
86 T C 0.0000
87 L C 0.0000
88 R C -1.2328
89 L C 0.0000
90 W C 0.0000
91 D C -0.6702
92 L C 0.0000
93 T C -0.5830
94 T C -0.5826
95 G C -0.8842
96 T C -0.7303
97 T C -1.2692
98 T C -0.9639
99 R C -1.7842
100 R C -1.7586
101 F C 0.0000
102 V C 1.2445
103 G C 0.5132
104 H C 0.0000
105 T C -1.0807
106 K C -2.2662
107 D C -1.3923
108 V C 0.0000
109 L C -0.0632
110 S C 0.0000
111 V C 0.0000
112 A C 0.0000
113 F C -0.6622
114 S C 0.0000
115 S C -1.5111
116 D C -2.6298
117 N C -2.2528
118 R C -2.5599
119 Q C -1.6676
120 I C 0.0000
121 V C 0.0000
122 S C 0.0000
123 G C 0.0000
124 S C 0.0000
125 R C -1.3395
126 D C -1.8277
127 K C -2.2064
128 T C 0.0000
129 I C 0.0000
130 K C -0.3142
131 L C 0.0000
132 W C 0.0000
133 N C -0.2714
134 T C -0.0519
135 L C 1.1746
136 G C 0.7832
137 V C 1.8353
138 C C 0.6949
139 K C -1.0377
140 Y C -0.4412
141 T C -0.7384
142 V C 0.0000
143 Q C -2.8184
144 D C -3.4003
145 E C -3.2274
146 S C 0.0000
147 H C 0.0000
148 S C -1.6022
149 E C -1.2073
150 W C -0.8272
151 V C 0.0000
152 S C -0.1473
153 C C 0.0000
154 V C 0.0000
155 R C -0.2028
156 F C 0.0402
157 S C -0.0892
158 P C -0.4880
159 N C 0.0000
160 S C -0.4343
161 S C -0.7611
162 N C -0.5820
163 P C -0.3605
164 I C 0.0000
165 I C 0.0000
166 V C 0.0000
167 S C 0.0000
168 C C 0.0000
169 G C 0.0000
170 W C -0.5827
171 D C -0.6435
172 K C -0.8804
173 L C 0.0615
174 V C 0.0000
175 K C 0.0000
176 V C 0.0000
177 W C 0.0000
178 N C -1.3945
179 L C -0.6290
180 A C -0.7458
181 N C -1.5429
182 C C 0.0000
183 K C -2.4846
184 L C -1.9062
185 K C -1.9384
186 T C -1.1839
187 N C -0.5810
188 H C 0.0000
189 I C 1.4534
190 G C 0.3436
191 H C 0.0000
192 T C -0.5518
193 G C -1.0521
194 Y C -0.7738
195 L C 0.0000
196 N C -0.5523
197 T C 0.0000
198 V C 0.0000
199 T C 0.0842
200 V C 0.1261
201 S C 0.0000
202 P C -0.2500
203 D C -0.2821
204 G C 0.0000
205 S C -0.7888
206 L C -0.3071
207 C C 0.0000
208 A C 0.0000
209 S C 0.0000
210 G C 0.0000
211 G C 0.0000
212 K C -2.0315
213 D C -1.7911
214 G C 0.0000
215 Q C -1.6984
216 A C 0.0000
217 M C 0.0000
218 L C 0.0000
219 W C 0.0000
220 D C -1.6682
221 L C 0.0000
222 N C -2.5586
223 E C -3.0680
224 G C -2.5688
225 K C -2.6933
226 H C -1.0288
227 L C 0.0339
228 Y C 0.1607
229 T C -0.5043
230 L C 0.0000
231 D C -2.2010
232 G C 0.0000
233 G C -1.5322
234 D C -1.6057
235 I C -0.9180
236 I C 0.0000
237 N C -0.5955
238 A C -0.1195
239 L C 0.0000
240 C C 0.1154
241 F C 0.0000
242 S C 0.0000
243 P C -0.5531
244 N C 0.0000
245 R C 0.0000
246 Y C -0.3244
247 W C 0.0000
248 L C 0.0000
249 C C 0.0000
250 A C 0.0000
251 A C 0.0000
252 T C 0.0000
253 G C 0.0000
254 P C -1.2590
255 S C 0.0000
256 I C 0.0000
257 K C -0.4720
258 I C 0.0000
259 W C 0.0000
260 D C -0.3292
261 L C 0.0000
262 E C -2.1416
263 G C -1.0762
264 K C -0.5908
265 I C 1.5218
266 I C 1.4499
267 V C 0.3683
268 D C -0.4826
269 E C -1.0434
270 L C 0.0000
271 K C -2.3878
272 Q C -1.8501
273 E C -1.6597
274 V C 0.6090
282 E C -1.9837
283 P C -1.8475
284 P C -1.3453
285 Q C -0.8634
286 C C 0.0000
287 T C -0.1084
288 S C 0.0000
289 L C 0.0000
290 A C -0.0162
291 W C 0.0000
292 S C -0.8609
293 A C -1.3796
294 D C -1.8916
295 G C 0.0000
296 Q C -0.9940
297 T C 0.0000
298 L C 0.0000
299 F C 0.0000
300 A C 0.0000
301 G C 0.0000
302 Y C 0.0000
303 T C -0.4077
304 D C -1.1438
305 N C -1.2932
306 L C -0.9195
307 V C 0.0000
308 R C 0.0000
309 V C 0.0000
310 W C 0.0000
311 Q C -0.8061
312 V C 0.0000
313 T C 0.1493
314 I C 1.2949

 

Laboratory of Theory of Biopolymers 2015