Project name: 2W9T_A_N48E

Status: done

submitted: 2017-05-19 19:28:24, status changed: 2017-05-19 19:36:12
Settings
Chain sequence(s) A: TLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDDQVDDMYITVIDGKFQGDTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRRKG
B: TLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDDQVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRRRKG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7891
Maximal score value
0.7178
Average score
-0.9212
Total score value
-292.9473

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -0.6236
2 L A 0.0000
3 S A 0.0000
4 I A 0.0000
5 I A 0.0000
6 V A 0.0000
7 A A 0.0230
8 H A 0.0000
9 D A 0.0000
10 K A -0.9955
11 Q A 0.0000
12 R A -0.3679
13 V A 0.0000
14 I A 0.0000
15 G A -0.6104
16 Y A 0.1734
17 Q A -0.6923
18 N A -1.2345
19 Q A -0.7799
20 L A 0.0000
21 P A -0.0756
22 W A 0.3384
23 H A -0.6771
24 L A 0.0000
25 P A -0.9182
26 N A -1.4515
27 D A 0.0000
28 L A -1.1775
29 K A -2.4114
30 H A -1.7773
31 I A 0.0000
32 K A -2.5373
33 Q A -2.2479
34 L A -1.1286
35 T A 0.0000
36 T A -1.5699
37 G A -1.6473
38 N A -1.4102
39 T A 0.0000
40 L A 0.0000
41 V A 0.0000
42 M A 0.0000
43 A A -1.1818
44 R A -2.2345
45 K A -2.8785
46 T A 0.0000
47 F A 0.0000
48 E A -3.0982
49 S A -2.0147
50 I A -1.4265
51 G A -1.9318
52 K A -2.4715
53 P A -1.6072
54 L A -1.0290
55 P A -1.4487
56 N A -1.9947
57 R A -1.8267
58 R A -1.8321
59 N A 0.0000
60 V A 0.0000
61 V A 0.0000
62 L A -0.9899
63 T A 0.0000
64 N A -2.0871
65 Q A -1.8659
66 A A -1.0124
67 S A -0.7965
68 F A -0.8062
69 H A -1.7826
70 H A -2.2498
71 E A -2.8818
72 G A -2.2439
73 V A -1.9788
74 D A -2.1132
75 V A -1.0591
76 I A 0.0000
77 N A -1.7336
78 S A -1.2490
79 L A -1.2517
80 D A -2.8561
81 E A -2.7084
82 I A 0.0000
83 K A -3.2483
84 E A -3.1757
85 L A -1.7787
86 S A -1.1546
87 G A -0.9807
88 H A -0.6548
89 V A 0.0000
90 F A 0.0000
91 I A 0.0000
92 F A 0.0000
93 G A 0.0000
94 G A 0.0000
95 Q A -0.6635
96 T A -0.6869
97 L A 0.0000
98 Y A 0.0000
99 E A -1.9079
100 A A -1.1121
101 M A 0.0000
102 I A 0.0000
103 D A -2.4609
104 Q A -1.8837
105 V A 0.0000
106 D A -1.3464
107 D A 0.0000
108 M A 0.0000
109 Y A 0.1841
110 I A 0.0000
111 T A 0.0000
112 V A 0.0000
113 I A 0.0000
114 D A -0.8123
115 G A -1.0819
116 K A -1.9388
117 F A -1.3486
118 Q A -1.8338
119 G A -1.6770
120 D A -2.0243
121 T A -0.8401
122 F A -0.1332
123 F A 0.0000
124 P A -0.6904
125 P A -0.4886
126 Y A 0.0000
127 T A 0.0000
128 F A 0.0000
129 E A -2.3026
130 N A -2.5050
131 W A 0.0000
132 E A -1.8788
133 V A 0.0000
134 E A -2.1550
135 S A -1.1306
136 S A 0.0000
137 V A 0.0137
138 E A -1.2913
139 G A 0.0000
140 Q A -1.5037
141 L A -1.1639
142 D A -2.2235
143 E A -2.8854
144 K A -2.8934
145 N A 0.0000
146 T A -0.9342
147 I A -0.4194
148 P A -0.5715
149 H A 0.0000
150 T A 0.0000
151 F A 0.0000
152 L A 0.0000
153 H A -0.3923
154 L A 0.0000
155 V A -1.2736
156 R A -2.5835
157 R A -3.4051
158 K A -3.0195
159 G A -1.7129
1 T B -0.6788
2 L B 0.0000
3 S B 0.0000
4 I B 0.0000
5 I B 0.0000
6 V B 0.0000
7 A B 0.0605
8 H B 0.0000
9 D B 0.0000
10 K B -3.0009
11 Q B -2.1012
12 R B -1.4942
13 V B 0.0000
14 I B 0.0000
15 G B -0.8533
16 Y B 0.0000
17 Q B -0.6099
18 N B 0.0000
19 Q B 0.0000
20 L B 0.0000
21 P B 0.0000
22 W B 0.0000
23 H B -0.3187
24 L B 0.0000
25 P B 0.0000
26 N B -0.8488
27 D B 0.0000
28 L B 0.0000
29 K B -1.7169
30 H B -1.2266
31 I B 0.0000
32 K B -1.9510
33 Q B -1.8198
34 L B -0.8573
35 T B 0.0000
36 T B -1.3753
37 G B -1.5259
38 N B -1.3660
39 T B 0.0000
40 L B 0.0000
41 V B 0.0000
42 M B 0.0000
43 A B -0.6501
44 R B -1.3131
45 K B -1.7660
46 T B 0.0000
47 F B 0.0000
48 E B -1.6352
49 S B 0.0000
50 I B 0.0000
51 G B -0.9702
52 K B -1.2813
53 P B -1.2768
54 L B 0.0000
55 P B -1.4401
56 N B -1.9887
57 R B -1.6437
58 R B -1.7316
59 N B 0.0000
60 V B 0.0000
61 V B 0.0000
62 L B -0.8473
63 T B 0.0000
64 N B -2.1407
65 Q B -2.0219
66 A B -1.1294
67 S B -0.8371
68 F B -0.8662
69 H B -1.8536
70 H B -2.0903
71 E B -2.7529
72 G B -2.0996
73 V B -1.8598
74 D B -2.1373
75 V B -1.1012
76 I B 0.0000
77 N B -1.7689
78 S B -1.2379
79 L B -1.2035
80 D B -2.8593
81 E B -2.6796
82 I B 0.0000
83 K B -3.2550
84 E B -3.1992
85 L B -1.8695
86 S B -1.2019
87 G B -1.0690
88 H B -0.6625
89 V B 0.0000
90 F B 0.0000
91 I B 0.0000
92 F B 0.0000
93 G B 0.0000
94 G B 0.0000
95 Q B -0.7558
96 T B -0.6751
97 L B 0.0000
98 Y B 0.0000
99 E B -2.0400
100 A B -1.1341
101 M B 0.0000
102 I B -1.4250
103 D B -2.4799
104 Q B -1.7935
105 V B 0.0000
106 D B -1.4771
107 D B 0.0000
108 M B 0.0000
109 Y B 0.3004
110 I B 0.0000
111 T B 0.0000
112 V B -0.6195
113 I B 0.0000
114 D B -2.4906
115 G B -2.0995
116 K B -2.8001
117 F B -1.9591
118 Q B -1.9694
119 G B -1.8113
120 D B -2.0500
121 T B -0.8526
122 F B -0.2116
123 F B 0.0000
124 P B 0.0000
125 P B -0.3670
126 Y B -0.2826
127 T B -0.3693
128 F B 0.0270
129 E B -2.3478
130 D B -3.4435
131 W B 0.0000
132 E B -2.2020
133 V B 0.1017
134 E B -1.4573
135 S B -0.2016
136 S B 0.3323
137 V B 0.7178
138 E B -1.0564
139 G B -0.7739
140 Q B -1.0868
141 L B -0.3476
142 D B -1.4438
143 E B -2.1552
144 K B -1.7182
145 N B 0.0000
146 T B -0.3535
147 I B -0.1974
148 P B -0.6328
149 H B 0.0000
150 T B -0.4474
151 F B 0.4390
152 L B 0.3539
153 H B -0.0102
154 L B 0.0000
155 V B -1.5170
156 R B -2.8308
157 R B -3.7891
158 K B -3.3281
159 G B -1.6798

 

Laboratory of Theory of Biopolymers 2015