Project name: a49c8e82ba78cf1 [mutate: GA30Y]

Chain sequence(s)	A: HQGTFTSDLSKQKDSRRAQDFIEWLKNGGPSSGAPPPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	GA30Y
Energy difference between WT (input) and mutated protein (by FoldX)	10.5979 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -5.3053
• Maximal score value: 0.557
• Average score: -1.7903
• Total score value: -68.0326

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	H	A	-1.3530
3	Q	A	-1.2525
4	G	A	-0.7862
5	T	A	-0.1386
6	F	A	0.5570
7	T	A	-0.5211
8	S	A	-1.2592
9	D	A	-2.4796
10	L	A	-1.7041
11	S	A	-2.9626
12	K	A	-4.5041
13	Q	A	-4.3862
14	K	A	-5.0966
15	D	A	-5.3053
16	S	A	-4.2009
17	R	A	-5.0739
18	R	A	-4.9457
19	A	A	-3.2561
20	Q	A	-3.0900
21	D	A	-3.2739
22	F	A	-1.1119
23	I	A	-0.4551
24	E	A	-2.1520
25	W	A	-0.8600
26	L	A	0.4038
27	K	A	-1.7341
28	N	A	-1.8568
29	G	A	-0.7289
30	Y	A	0.3951	mutated: GA30Y
31	P	A	-0.1448
32	S	A	-0.5518
33	S	A	-0.8796
34	G	A	-0.7531
35	A	A	-0.4703
36	P	A	-0.4146
37	P	A	-0.1312
38	P	A	-0.9126
39	S	A	-0.6421