Project name: e4427f306d27850

Status: done

submitted: 2017-12-06 11:48:51, status changed: 2017-12-06 12:27:00
Settings
Chain sequence(s) A: MEFGLSWLFLVAILKGVQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVASIRSGGGRTYYSDNVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAIIGLMVGGVVIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEALGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVICFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: MDMRVPAQLLGLLMLWVSGSSGDVVMTQSPLSLPVTPGEPASISCKSSQSLLDSDGKTYLNWLLQKPGQSPQRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: MEFGLSWLFLVAILKGVQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVASIRSGGGRTYYSDNVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAIIGLMVGGVVIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEALGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVICFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: MDMRVPAQLLGLLMLWVSGSSGDVVMTQSPLSLPVTPGEPASISCKSSQSLLDSDGKTYLNWLLQKPGQSPQRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.061
Maximal score value
4.1943
Average score
-0.6198
Total score value
-880.0814

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.5333
2 E A -0.1416
3 F A 1.4100
4 G A 1.0094
5 L A 1.8428
6 S A 1.5420
7 W A 2.3554
8 L A 2.9541
9 F A 3.7945
10 L A 4.1943
11 V A 3.9198
12 A A 3.1030
13 I A 3.1889
14 L A 2.1838
15 K A -0.0022
16 G A 0.5517
17 V A 1.9376
18 Q A 1.6081
19 C A 1.1494
20 E A 0.1656
21 V A 0.1528
22 Q A 0.4328
23 L A 0.0000
24 L A 1.0223
25 E A 0.0602
26 S A -0.4484
27 G A -0.5646
28 G A -0.1652
29 G A 0.0474
30 L A 0.6285
31 V A -0.3522
32 Q A -1.5353
33 P A -1.8777
34 G A -1.4822
35 G A -0.9923
36 S A -1.2680
37 L A -0.9757
38 R A -1.9752
39 L A 0.0000
40 S A -0.3750
41 C A 0.0000
42 A A -0.1729
43 A A 0.0000
44 S A -0.3145
45 G A -0.3502
46 F A -0.0444
47 T A -0.5694
48 F A 0.0000
49 S A -1.7025
50 N A -1.3919
51 Y A -0.3724
52 G A -1.0430
53 M A 0.0000
54 S A -0.0498
55 W A 0.0000
56 V A 0.0000
57 R A -0.6136
58 Q A -0.9690
59 A A 0.0000
60 P A -1.3203
61 G A -1.6073
62 K A -2.4830
63 G A -1.7637
64 L A 0.0000
65 E A -1.4100
66 W A 0.0000
67 V A 0.0000
68 A A 0.0000
69 S A -0.4016
70 I A 0.0000
71 R A -2.9273
72 S A -2.5406
73 G A -2.1627
74 G A -2.0222
75 G A -2.4921
76 R A -2.7088
77 T A -1.2966
78 Y A -0.1339
79 Y A -0.6228
80 S A -1.5623
81 D A -2.6719
82 N A -2.6710
83 V A 0.0000
84 K A -2.6567
85 G A -2.0472
86 R A -1.8212
87 F A 0.0000
88 T A -0.9178
89 I A 0.0000
90 S A -1.2208
91 R A -2.0685
92 D A -2.3048
93 N A -2.7799
94 S A -2.1308
95 K A -2.7908
96 N A -2.3380
97 T A 0.0000
98 L A 0.0000
99 Y A -0.6162
100 L A 0.0000
101 Q A -1.2975
102 M A 0.0000
103 N A -1.3884
104 S A -1.2429
105 L A 0.0000
106 R A -2.6985
107 A A -1.9543
108 E A -2.3597
109 D A 0.0000
110 T A -0.5695
111 A A 0.0000
112 V A 0.4430
113 Y A 0.0000
114 Y A 0.0000
115 C A 0.0000
116 A A 0.1127
117 I A 0.6819
118 I A 0.7135
119 G A 0.0000
120 L A 0.0000
121 M A 0.5912
122 V A 0.2257
123 G A 0.5791
124 G A 0.4656
125 V A 0.1708
126 V A 0.0000
127 I A 0.5143
128 W A 0.0000
129 G A 0.0000
130 Q A -0.9866
131 G A 0.0000
132 T A 0.0000
133 L A 0.9293
134 V A 0.0000
135 T A 0.0000
136 V A 0.0000
137 S A -1.0286
138 S A -0.8443
139 A A -0.5984
140 S A -0.5981
141 T A -0.7856
142 K A -1.4202
143 G A -1.4254
144 P A -0.6486
145 S A -0.1018
146 V A -0.3775
147 F A -0.3160
148 P A -0.9383
149 L A 0.0000
150 A A 0.0000
151 P A 0.0000
152 S A -0.8715
153 S A -0.6754
154 K A -1.1103
155 S A -0.9598
156 T A -0.9187
157 S A -0.8096
158 G A -0.8673
159 G A -0.9088
160 T A -0.6935
161 A A 0.0000
162 A A 0.0000
163 L A 0.0000
164 G A 0.0000
165 C A 0.0000
166 L A 0.0000
167 V A 0.0000
168 K A 0.0000
169 D A -0.4907
170 Y A 0.0000
171 F A 0.0000
172 P A -0.6194
173 E A -0.8879
174 P A -0.8826
175 V A -0.7569
176 T A -0.6261
177 V A -0.2835
178 S A -0.5039
179 W A 0.0000
180 N A -0.9053
181 S A -0.7859
182 G A -0.6410
183 A A -0.3120
184 L A -0.0530
185 T A -0.2092
186 S A -0.1817
187 G A -0.2097
188 V A 0.1830
189 H A -0.0954
190 T A 0.0187
191 F A 0.0000
192 P A -0.3806
193 A A 0.0426
194 V A 0.2608
195 L A 0.6730
196 Q A 0.0777
197 S A -0.1514
198 S A -0.2620
199 G A -0.0804
200 L A -0.0544
201 Y A 0.3167
202 S A 0.1192
203 L A 0.0000
204 S A 0.0000
205 S A 0.0000
206 V A 0.0000
207 V A 0.0000
208 T A -0.1483
209 V A 0.0000
210 P A -0.5458
211 S A -0.5723
212 S A -0.5593
213 S A -0.7007
214 L A -0.8710
215 G A -1.0604
216 T A -0.8882
217 Q A -1.5394
218 T A -1.2151
219 Y A 0.0000
220 I A -1.3928
221 C A 0.0000
222 N A -1.7157
223 V A 0.0000
224 N A -1.9279
225 H A 0.0000
226 K A -2.6759
227 P A -1.6460
228 S A -1.9350
229 N A -2.4577
230 T A -2.1019
231 K A -2.6835
232 V A -1.5974
233 D A -2.6724
234 K A -2.1883
235 K A -2.3233
236 V A 0.0000
237 E A -2.7213
238 P A -1.6566
239 K A -1.8086
240 S A -1.4612
241 C A -1.2094
242 D A -2.8634
243 K A -3.2123
244 T A -2.2540
245 H A -2.5446
246 T A -1.7906
247 C A -0.6355
248 P A -0.6696
249 P A -0.0448
250 C A 0.4215
251 P A -0.2523
252 A A -1.1160
253 P A -1.5948
254 E A -2.1153
255 A A -0.5423
256 L A 0.5208
257 G A -0.0199
258 A A -0.4837
259 P A 0.0000
260 S A 0.0777
261 V A 0.0000
262 F A 1.3772
263 L A 1.1752
264 F A 1.5819
265 P A 0.0917
266 P A 0.0000
267 K A -2.1816
268 P A -1.3899
269 K A -1.3116
270 D A -1.3718
271 T A 0.0000
272 L A 0.0000
273 M A 0.1903
274 I A 1.2092
275 S A -0.2166
276 R A -1.7483
277 T A -0.8663
278 P A 0.0000
279 E A -0.8500
280 V A 0.0000
281 T A 0.6454
282 C A 0.0000
283 V A 0.0000
284 V A 0.0000
285 V A -0.9203
286 D A -1.6470
287 V A 0.0000
288 S A -2.2457
289 H A -2.6075
290 E A -3.0947
291 D A -2.4719
292 P A -2.2833
293 E A -2.0983
294 V A -0.1587
295 I A 1.6890
296 C A 1.2113
297 F A 0.6094
298 N A -0.4194
299 W A 0.0000
300 Y A -1.0916
301 V A -0.9217
302 D A -1.7191
303 G A -0.6899
304 V A 0.5312
305 E A -1.3344
306 V A -0.8899
307 H A -1.9782
308 N A -2.1301
309 A A -1.5575
310 K A -2.0346
311 T A -1.1989
312 K A -2.2779
313 P A -2.2009
314 R A -3.5589
315 E A -4.0610
316 E A -3.5463
317 Q A -2.1222
318 Y A 0.0269
319 N A -1.2126
320 S A -1.3103
321 T A -1.9847
322 Y A -2.9478
323 R A -3.2160
324 V A 0.0000
325 V A -0.8071
326 S A 0.0000
327 V A 0.0000
328 L A 0.0000
329 T A -0.4965
330 V A 0.0000
331 L A 0.0240
332 H A -0.6096
333 Q A -1.5824
334 D A -1.6497
335 W A 0.0000
336 L A -1.1576
337 N A -2.2424
338 G A -2.1894
339 K A -2.3500
340 E A -2.6777
341 Y A 0.0000
342 K A -1.5435
343 C A 0.0000
344 K A -0.8038
345 V A 0.0000
346 S A -0.1125
347 N A 0.0000
348 K A -2.0871
349 A A -1.6694
350 L A 0.0000
351 P A -0.6216
352 A A -0.4593
353 P A -0.5014
354 I A -0.3345
355 E A -1.4980
356 K A -0.9649
357 T A -0.9568
358 I A -0.4114
359 S A -1.3094
360 K A -1.3697
361 A A -0.9866
362 K A -2.2348
363 G A -1.7776
364 Q A -1.8489
365 P A -1.7477
366 R A -1.9338
367 E A -2.4338
368 P A 0.0000
369 Q A -1.3786
370 V A 0.0000
371 Y A 0.0000
372 T A 0.0000
373 L A 0.0000
374 P A -0.4413
375 P A 0.0000
376 S A 0.0000
377 R A -2.7453
378 E A -2.7401
379 E A 0.0000
380 M A -1.9610
381 T A -1.8373
382 K A -2.8485
383 N A -2.8938
384 Q A -2.7692
385 V A 0.0000
386 S A 0.0000
387 L A 0.0000
388 T A 0.0000
389 C A 0.0000
390 L A 0.0000
391 V A 0.0000
392 K A -0.5179
393 G A -1.0024
394 F A 0.0000
395 Y A -0.8764
396 P A 0.0000
397 S A -0.2715
398 D A -0.7447
399 I A -0.4192
400 A A -0.4215
401 V A -0.2419
402 E A -0.9529
403 W A 0.0000
404 E A -1.7257
405 S A 0.0000
406 N A -1.8560
407 G A -1.8957
408 Q A -2.3426
409 P A -2.0110
410 E A -1.9751
411 N A -2.3579
412 N A -2.0971
413 Y A -1.3208
414 K A -1.2440
415 T A -0.4171
416 T A 0.0000
417 P A -0.2281
418 P A 0.0362
419 V A 0.0000
420 L A 0.4354
421 D A -0.5932
422 S A -1.1268
423 D A -1.8549
424 G A -0.8809
425 S A 0.0000
426 F A 0.0721
427 F A 0.0000
428 L A 0.0000
429 Y A 0.0000
430 S A 0.0000
431 K A 0.0000
432 L A 0.0000
433 T A -1.2319
434 V A 0.0000
435 D A -2.9198
436 K A -2.8349
437 S A -2.1771
438 R A -1.9346
439 W A 0.0000
440 Q A -2.0981
441 Q A -2.1767
442 G A -1.3556
443 N A -0.6563
444 V A 0.5550
445 F A 0.0000
446 S A -0.7149
447 C A 0.0000
448 S A 0.0000
449 V A 0.0000
450 M A 0.0000
451 H A 0.0000
452 E A -1.0003
453 A A -1.4889
454 L A -1.4549
455 H A -1.8073
456 N A -1.7169
457 H A -1.2037
458 Y A -0.4863
459 T A -0.7966
460 Q A -1.2897
461 K A -1.2191
462 S A -0.4106
463 L A 0.0000
464 S A -0.0075
465 L A -0.5622
466 S A -0.7183
467 P A -0.9876
468 G A -1.6414
469 K A -2.4182
470 M B 0.8421
471 E B -0.2518
472 F B 1.3759
473 G B 0.9972
474 L B 1.9198
475 S B 1.7261
476 W B 2.6253
477 L B 3.6113
478 F B 3.9714
479 L B 4.0961
480 V B 3.9067
481 A B 2.7627
482 I B 2.8764
483 L B 1.9921
484 K B -0.3529
485 G B 0.0525
486 V B 0.8486
487 Q B -0.4914
488 C B -0.3754
489 E B -1.5943
490 V B -0.6234
491 Q B -0.6845
492 L B 0.0000
493 L B 1.1168
494 E B 0.1629
495 S B -0.5050
496 G B -0.5701
497 G B -0.5441
498 G B -0.1093
499 L B 0.8634
500 V B 0.0894
501 Q B -0.9634
502 P B -1.3846
503 G B -1.1774
504 G B -0.7746
505 S B -0.8894
506 L B -0.8097
507 R B -1.8966
508 L B 0.0000
509 S B -0.4075
510 C B 0.0000
511 A B -0.2815
512 A B 0.0000
513 S B -0.5435
514 G B -0.9262
515 F B -0.4156
516 T B -0.5843
517 F B 0.0000
518 S B -1.5559
519 N B -1.3969
520 Y B -0.4744
521 G B 0.0000
522 M B 0.0000
523 S B 0.0000
524 W B 0.0000
525 V B 0.0000
526 R B 0.0000
527 Q B -1.1175
528 A B 0.0000
529 P B -1.3164
530 G B -1.6310
531 K B -2.5518
532 G B -1.8643
533 L B 0.0000
534 E B -1.6235
535 W B -0.4551
536 V B 0.0000
537 A B 0.0000
538 S B 0.0000
539 I B 0.0000
540 R B -2.0933
541 S B 0.0000
542 G B -1.9189
543 G B -1.9655
544 G B -2.2610
545 R B -2.5509
546 T B -1.0959
547 Y B -0.2999
548 Y B -0.4843
549 S B -1.4833
550 D B -2.6530
551 N B -2.5546
552 V B 0.0000
553 K B -1.7957
554 G B 0.1785
555 R B -0.1839
556 F B 0.0000
557 T B -0.4391
558 I B 0.0000
559 S B -0.8760
560 R B -1.4627
561 D B -2.0216
562 N B -2.4582
563 S B -1.9801
564 K B -2.7133
565 N B -2.2038
566 T B 0.0000
567 L B 0.0000
568 Y B -0.5962
569 L B 0.0000
570 Q B -1.1725
571 M B 0.0000
572 N B -0.6881
573 S B -0.7984
574 L B 0.0000
575 R B -1.9282
576 A B -1.6074
577 E B -2.1562
578 D B 0.0000
579 T B -0.7098
580 A B 0.0000
581 V B 0.0096
582 Y B 0.0000
583 Y B 0.0000
584 C B 0.0000
585 A B 0.0000
586 I B 0.0000
587 I B 0.0000
588 G B 0.0000
589 L B 1.2670
590 M B 1.4131
591 V B 1.8272
592 G B 1.0321
593 G B 1.3499
594 V B 2.4374
595 V B 2.7031
596 I B 2.0124
597 W B 0.5958
598 G B 0.2688
599 Q B 0.0000
600 G B 0.0000
601 T B 0.0000
602 L B 0.0000
603 V B 0.1067
604 T B -0.2022
605 V B 0.0000
606 S B 0.0000
607 S B -0.3700
608 A B -0.2548
609 S B 0.0000
610 T B -0.1535
611 K B 0.0000
612 G B -0.6139
613 P B -0.2442
614 S B -0.0898
615 V B 1.0838
616 F B 2.0927
617 P B 0.9932
618 L B 0.7970
619 A B -0.5298
620 P B 0.0000
621 S B -0.2939
622 S B -1.0042
623 K B -1.3141
624 S B 0.0000
625 T B 0.0000
626 S B -1.0718
627 G B -0.8373
628 G B -0.5430
629 T B -0.4009
630 A B -0.2834
631 A B 0.0000
632 L B 0.0000
633 G B 0.0000
634 C B 0.0000
635 L B 0.0000
636 V B 0.0000
637 K B -0.3609
638 D B -0.1474
639 Y B 0.0000
640 F B 0.0000
641 P B -0.0363
642 E B -1.1483
643 P B -1.0303
644 V B -0.8527
645 T B -0.7380
646 V B -0.3906
647 S B -0.4501
648 W B 0.0000
649 N B -0.7164
650 S B -0.6922
651 G B -0.5892
652 A B -0.2679
653 L B 0.0066
654 T B -0.1874
655 S B -0.2009
656 G B -0.2918
657 V B 0.1009
658 H B -0.2251
659 T B -0.0523
660 F B 0.0000
661 P B -0.4829
662 A B 0.1019
663 V B 0.4058
664 L B 1.3347
665 Q B 0.2806
666 S B 0.0165
667 S B -0.0810
668 G B 0.4801
669 L B 0.6343
670 Y B 0.5117
671 S B 0.0972
672 L B 0.0000
673 S B 0.0000
674 S B 0.0000
675 V B 0.0000
676 V B 0.0000
677 T B -0.2199
678 V B 0.0000
679 P B -0.4420
680 S B -0.6895
681 S B -0.8149
682 S B -0.8519
683 L B -1.3137
684 G B -1.6933
685 T B -0.9826
686 Q B -1.4446
687 T B -1.1329
688 Y B 0.0000
689 I B -1.0589
690 C B 0.0000
691 N B -1.3736
692 V B 0.0000
693 N B -1.9872
694 H B 0.0000
695 K B -2.7107
696 P B -1.4636
697 S B -1.3321
698 N B -2.1926
699 T B -1.9228
700 K B -2.5295
701 V B -1.1930
702 D B -2.3096
703 K B -1.9266
704 K B -2.0029
705 V B 0.0000
706 E B -2.3000
707 P B -1.8414
708 K B -1.7383
709 S B -1.2399
710 C B -0.7637
711 D B -1.9071
712 K B -2.7556
713 T B -1.7214
714 H B -1.6882
715 T B -0.8589
716 C B -0.1236
717 P B -0.1928
718 P B 0.0193
719 C B 0.2756
720 P B -0.4884
721 A B -0.7309
722 P B -1.0278
723 E B -1.8613
724 A B -0.4116
725 L B 0.4363
726 G B -0.1914
727 A B -0.3914
728 P B 0.0000
729 S B -0.2357
730 V B 0.0000
731 F B 1.0068
732 L B 0.0000
733 F B 1.3584
734 P B 0.0896
735 P B 0.0000
736 K B -1.8455
737 P B -1.4063
738 K B -1.4356
739 D B -1.3446
740 T B 0.0000
741 L B -0.4805
742 M B 0.4531
743 I B 1.3967
744 S B -0.0342
745 R B -1.6380
746 T B -0.7748
747 P B 0.0000
748 E B -0.7862
749 V B 0.0000
750 T B 0.3121
751 C B 0.0000
752 V B 0.0000
753 V B 0.0000
754 V B -0.9748
755 D B -2.2477
756 V B 0.0000
757 S B -1.3209
758 H B -1.4558
759 E B -1.1902
760 D B -1.4944
761 P B -1.6489
762 E B -1.8120
763 V B -0.0772
764 I B 1.5834
765 C B 0.0000
766 F B 0.7831
767 N B -0.3439
768 W B 0.0000
769 Y B -0.8309
770 V B -1.0300
771 D B -2.1323
772 G B -0.9871
773 V B 0.3622
774 E B -1.4456
775 V B -0.9097
776 H B -1.9920
777 N B -2.2626
778 A B -1.6599
779 K B -2.3261
780 T B -1.2438
781 K B -2.2958
782 P B -2.3352
783 R B -3.4413
784 E B -3.7292
785 E B -3.5453
786 Q B -2.1479
787 Y B -0.2198
788 N B -1.3321
789 S B -1.2409
790 T B -2.0450
791 Y B -2.7112
792 R B -2.7286
793 V B 0.0000
794 V B -0.8669
795 S B 0.0000
796 V B 0.0000
797 L B 0.0000
798 T B -0.5550
799 V B 0.0000
800 L B 0.6191
801 H B -0.1463
802 Q B -1.3322
803 D B -1.4050
804 W B 0.0000
805 L B -0.9719
806 N B -1.9756
807 G B -2.2275
808 K B -2.3282
809 E B -2.3388
810 Y B 0.0000
811 K B -1.7899
812 C B 0.0000
813 K B -0.7954
814 V B 0.0000
815 S B 0.0484
816 N B -0.5698
817 K B -1.9005
818 A B 0.0000
819 L B 0.0000
820 P B -0.5953
821 A B -0.5637
822 P B -0.3786
823 I B -0.7102
824 E B -1.9990
825 K B -1.3710
826 T B -1.0802
827 I B -0.2503
828 S B -1.1024
829 K B -1.4073
830 A B -1.2674
831 K B -2.2732
832 G B -2.0846
833 Q B -2.3059
834 P B -2.0953
835 R B -2.5387
836 E B -2.5118
837 P B 0.0000
838 Q B -1.1532
839 V B 0.0000
840 Y B 0.0000
841 T B 0.0000
842 L B 0.0000
843 P B -0.3687
844 P B 0.0000
845 S B -1.5645
846 R B -2.7342
847 E B -2.8553
848 E B 0.0000
849 M B -1.8848
850 T B -1.5070
851 K B -1.7939
852 N B -2.3449
853 Q B -2.2805
854 V B 0.0000
855 S B 0.0000
856 L B 0.0000
857 T B 0.0000
858 C B 0.0000
859 L B 0.0000
860 V B 0.0000
861 K B -0.5038
862 G B -1.0377
863 F B 0.0000
864 Y B -1.3094
865 P B 0.0000
866 S B -0.4600
867 D B -1.3608
868 I B 0.0000
869 A B 0.0000
870 V B 0.0000
871 E B -1.2509
872 W B 0.0000
873 E B -1.8450
874 S B 0.0000
875 N B -1.9175
876 G B -1.8996
877 Q B -2.3452
878 P B -1.9751
879 E B -1.8509
880 N B -1.9507
881 N B -1.1922
882 Y B -0.7497
883 K B -0.8635
884 T B -0.3881
885 T B 0.0000
886 P B -0.2975
887 P B -0.0899
888 V B 0.0000
889 L B 0.5281
890 D B -0.7634
891 S B -1.3465
892 D B -1.9091
893 G B -0.9182
894 S B 0.0000
895 F B -0.0585
896 F B 0.0000
897 L B 0.0000
898 Y B 0.0000
899 S B 0.0000
900 K B 0.0000
901 L B 0.0000
902 T B 0.0000
903 V B 0.0000
904 D B -2.3917
905 K B -2.6250
906 S B -2.3102
907 R B -2.0877
908 W B 0.0000
909 Q B -2.3727
910 Q B -2.1558
911 G B -1.1340
912 N B -0.7521
913 V B 0.3329
914 F B 0.0000
915 S B -0.8682
916 C B 0.0000
917 S B 0.0000
918 V B 0.0000
919 M B 0.0000
920 H B 0.0000
921 E B -1.2965
922 A B -1.7188
923 L B 0.0000
924 H B -1.8850
925 N B -1.8172
926 H B -1.3380
927 Y B -0.4968
928 T B -0.8864
929 Q B -1.4403
930 K B -1.1363
931 S B -0.5178
932 L B 0.0000
933 S B -0.0768
934 L B -0.2098
935 S B -0.6036
936 P B -0.8781
937 G B -1.4208
938 K B -2.0154
939 M C -0.2699
940 D C -0.4065
941 M C -0.0018
942 R C 0.0000
943 V C 0.0000
944 P C -0.9650
945 A C -0.5640
946 Q C -0.1729
947 L C 1.7367
948 L C 2.5047
949 G C 2.2647
950 L C 3.3544
951 L C 3.2247
952 M C 3.1221
953 L C 3.2856
954 W C 2.8745
955 V C 2.3729
956 S C 0.5326
957 G C -0.4173
958 S C -1.1486
959 S C -1.4863
960 G C -1.2896
961 D C -1.3716
962 V C 0.0000
963 V C 0.6133
964 M C 0.0000
965 T C 0.0219
966 Q C 0.0000
967 S C 0.0619
968 P C 0.4750
969 L C 1.1630
970 S C 0.2894
971 L C 0.2168
972 P C -0.6164
973 V C -0.9472
974 T C -1.6671
975 P C -1.9137
976 G C -2.2165
977 E C -2.6970
978 P C -2.3520
979 A C 0.0000
980 S C -1.0952
981 I C 0.0000
982 S C -0.7577
983 C C 0.0000
984 K C -1.2722
985 S C 0.0000
986 S C -0.3246
987 Q C -0.2424
988 S C 0.0000
989 L C 0.0000
990 L C 1.1196
991 D C 0.3758
992 S C 0.2315
993 D C 0.4217
994 G C 0.0000
995 K C 0.0000
996 T C 0.4086
997 Y C 0.8792
998 L C 0.0000
999 N C 0.0000
1000 W C 0.0000
1001 L C 0.0000
1002 L C 0.0000
1003 Q C -0.7034
1004 K C -1.0880
1005 P C -1.1283
1006 G C -1.2570
1007 Q C -1.3261
1008 S C 0.0000
1009 P C 0.0000
1010 Q C -0.3429
1011 R C -0.1517
1012 L C 0.0000
1013 I C 0.0000
1014 Y C 0.4040
1015 L C 0.8357
1016 V C 0.0000
1017 S C -0.5275
1018 K C -1.0069
1019 L C -0.7643
1020 D C 0.0000
1021 S C -0.3870
1022 G C -0.1215
1023 V C -0.6978
1024 P C -1.1806
1025 D C -2.0680
1026 R C -2.2926
1027 F C 0.0000
1028 S C -1.3566
1029 G C 0.0000
1030 S C -0.9443
1031 G C -1.1562
1032 S C -0.8757
1033 G C -0.5065
1034 T C -1.3685
1035 D C -2.2087
1036 F C 0.0000
1037 T C -1.1197
1038 L C 0.0000
1039 K C -1.9822
1040 I C 0.0000
1041 S C -2.5630
1042 R C -3.3548
1043 V C 0.0000
1044 E C -2.7910
1045 A C -1.6389
1046 E C -2.2133
1047 D C 0.0000
1048 V C -0.5647
1049 G C 0.0000
1050 V C -0.3126
1051 Y C 0.0000
1052 Y C 0.0000
1053 C C 0.0000
1054 W C 0.0000
1055 Q C 0.0000
1056 G C 0.0000
1057 T C -0.4496
1058 H C -0.2160
1059 F C -0.0609
1060 P C -0.7057
1061 R C -0.8849
1062 T C -0.4215
1063 F C -0.2649
1064 G C 0.0000
1065 Q C -0.7306
1066 G C 0.0000
1067 T C 0.0000
1068 K C -0.3499
1069 V C 0.0000
1070 E C 0.0000
1071 I C -0.8692
1072 K C -1.7757
1073 R C -2.0975
1074 T C -0.4833
1075 V C 0.8840
1076 A C 0.1838
1077 A C 0.0612
1078 P C 0.0000
1079 S C -0.1950
1080 V C 0.0000
1081 F C 0.0000
1082 I C -0.0560
1083 F C 0.0000
1084 P C -0.5554
1085 P C 0.0000
1086 S C 0.0000
1087 D C -2.5440
1088 E C -2.0088
1089 Q C 0.0000
1090 L C -1.6791
1091 K C -2.4438
1092 S C -1.6024
1093 G C -1.1023
1094 T C -0.7380
1095 A C 0.0000
1096 S C 0.0000
1097 V C 0.0000
1098 V C 0.0000
1099 C C 0.0000
1100 L C 0.0000
1101 L C 0.0000
1102 N C -0.3398
1103 N C -0.7714
1104 F C 0.0000
1105 Y C 0.0000
1106 P C -1.5649
1107 R C -2.7633
1108 E C -3.0340
1109 A C -2.2033
1110 K C -2.2489
1111 V C -0.9616
1112 Q C -0.4448
1113 W C 0.0000
1114 K C -0.5840
1115 V C 0.0000
1116 D C -2.1216
1117 N C -1.6179
1118 A C -0.3497
1119 L C 0.7040
1120 Q C -0.3542
1121 S C -0.7226
1122 G C -1.2801
1123 N C -1.5910
1124 S C -1.4633
1125 Q C -1.5751
1126 E C -1.8935
1127 S C -0.7795
1128 V C -0.6153
1129 T C -1.0588
1130 E C -2.1487
1131 Q C -1.7837
1132 D C -1.9411
1133 S C -1.7570
1134 K C -2.3321
1135 D C -2.0789
1136 S C 0.0000
1137 T C -1.5715
1138 Y C 0.0000
1139 S C 0.0000
1140 L C 0.0000
1141 S C 0.0000
1142 S C 0.0000
1143 T C -0.7723
1144 L C 0.0000
1145 T C -0.5103
1146 L C -0.6122
1147 S C -1.0041
1148 K C -1.8012
1149 A C -1.6172
1150 D C -1.9189
1151 Y C 0.0000
1152 E C -3.7192
1153 K C -3.6350
1154 H C -3.2962
1155 K C -3.6360
1156 V C -1.7756
1157 Y C 0.0000
1158 A C 0.0000
1159 C C 0.0000
1160 E C -0.5370
1161 V C 0.0000
1162 T C -1.1115
1163 H C 0.0000
1164 Q C -1.6327
1165 G C -0.3294
1166 L C -0.2318
1167 S C -0.4874
1168 S C -0.4391
1169 P C -0.5570
1170 V C 0.0513
1171 T C -0.3604
1172 K C -0.6706
1173 S C -0.3368
1174 F C -1.0277
1175 N C -2.1904
1176 R C -3.4716
1177 G C -2.7700
1178 E C -2.6338
1179 C C -1.1117
1180 M D 0.2367
1181 D D -0.9776
1182 M D -0.0172
1183 R D -0.8327
1184 V D 0.6850
1185 P D 0.2939
1186 A D 0.1653
1187 Q D 0.0571
1188 L D 1.7597
1189 L D 2.3156
1190 G D 1.7264
1191 L D 2.7226
1192 L D 2.9825
1193 M D 2.2461
1194 L D 2.9187
1195 W D 2.5107
1196 V D 1.5807
1197 S D 0.1441
1198 G D -1.0256
1199 S D -1.4803
1200 S D -1.5566
1201 G D -1.0241
1202 D D -1.8323
1203 V D -0.3965
1204 V D 0.5695
1205 M D 0.0000
1206 T D -0.4292
1207 Q D 0.0000
1208 S D -0.1716
1209 P D 0.4520
1210 L D 1.1582
1211 S D 0.4800
1212 L D 0.2306
1213 P D -0.3726
1214 V D 0.0000
1215 T D 0.0000
1216 P D -1.8265
1217 G D -1.9211
1218 E D -2.0121
1219 P D -1.7823
1220 A D 0.0000
1221 S D -0.8142
1222 I D 0.0000
1223 S D -0.7733
1224 C D 0.0000
1225 K D -1.8189
1226 S D 0.0000
1227 S D -0.8927
1228 Q D -1.1363
1229 S D -0.8586
1230 L D -0.2751
1231 L D 0.4516
1232 D D -1.0213
1233 S D -0.3116
1234 D D 0.0000
1235 G D 0.0000
1236 K D 0.0000
1237 T D 0.0000
1238 Y D 0.0000
1239 L D 0.0000
1240 N D 0.0000
1241 W D 0.0000
1242 L D 0.0000
1243 L D 0.0000
1244 Q D -0.9307
1245 K D -1.4116
1246 P D -1.3451
1247 G D -1.3618
1248 Q D -1.8885
1249 S D -1.2362
1250 P D 0.0000
1251 Q D -1.2346
1252 R D -0.6498
1253 L D 0.0000
1254 I D 0.0000
1255 Y D 0.0000
1256 L D -0.1146
1257 V D -0.2867
1258 S D -0.7564
1259 K D -1.4276
1260 L D -0.8787
1261 D D -0.5527
1262 S D -0.4955
1263 G D -0.8038
1264 V D -0.7100
1265 P D -1.1154
1266 D D -2.1580
1267 R D -2.0980
1268 F D 0.0000
1269 S D -1.3551
1270 G D 0.0000
1271 S D -0.8302
1272 G D -0.8144
1273 S D -0.5906
1274 G D -0.7678
1275 T D -1.1670
1276 D D -1.7341
1277 F D 0.0000
1278 T D -0.9804
1279 L D 0.0000
1280 K D -1.9018
1281 I D 0.0000
1282 S D -2.3116
1283 R D -3.2011
1284 V D 0.0000
1285 E D -2.5532
1286 A D -1.4636
1287 E D -2.1913
1288 D D 0.0000
1289 V D -0.5125
1290 G D 0.0000
1291 V D -0.0329
1292 Y D 0.0000
1293 Y D 0.0000
1294 C D 0.0000
1295 W D 0.0000
1296 Q D 0.0000
1297 G D 0.0000
1298 T D -0.2751
1299 H D -0.2683
1300 F D 0.8038
1301 P D -0.0145
1302 R D 0.0000
1303 T D -0.0652
1304 F D -0.0678
1305 G D 0.0000
1306 Q D -1.0829
1307 G D 0.0000
1308 T D 0.0000
1309 K D -0.1638
1310 V D 0.0000
1311 E D 0.0000
1312 I D -0.3767
1313 K D -0.6138
1314 R D 0.0000
1315 T D 0.0333
1316 V D 0.5685
1317 A D 0.0000
1318 A D -0.0091
1319 P D 0.0000
1320 S D -0.2887
1321 V D 0.0000
1322 F D -0.0121
1323 I D 0.0391
1324 F D 0.0000
1325 P D -0.8087
1326 P D 0.0000
1327 S D -1.6874
1328 D D -2.9812
1329 E D -3.0305
1330 Q D 0.0000
1331 L D -2.4044
1332 K D -2.8764
1333 S D -1.8881
1334 G D -1.3551
1335 T D -1.0204
1336 A D 0.0000
1337 S D 0.0000
1338 V D 0.0000
1339 V D 0.0000
1340 C D 0.0000
1341 L D 0.0000
1342 L D 0.0000
1343 N D -0.3888
1344 N D -0.8493
1345 F D 0.0000
1346 Y D 0.0000
1347 P D -1.1956
1348 R D -2.1290
1349 E D -2.8027
1350 A D -2.1686
1351 K D -2.2374
1352 V D -1.0988
1353 Q D -0.6510
1354 W D 0.0000
1355 K D -0.4506
1356 V D 0.0000
1357 D D -1.8551
1358 N D -1.4401
1359 A D -0.1480
1360 L D 0.9124
1361 Q D -0.0643
1362 S D -0.4673
1363 G D -0.9205
1364 N D -0.8222
1365 S D -1.2829
1366 Q D -1.7812
1367 E D -2.1494
1368 S D -1.1473
1369 V D -0.9655
1370 T D -1.1290
1371 E D -2.2187
1372 Q D -1.8442
1373 D D -2.1021
1374 S D -1.7919
1375 K D -2.5482
1376 D D -2.0920
1377 S D 0.0000
1378 T D 0.0000
1379 Y D 0.0000
1380 S D 0.0000
1381 L D 0.0000
1382 S D 0.0000
1383 S D 0.0000
1384 T D -0.7716
1385 L D 0.0000
1386 T D -0.4007
1387 L D -0.4547
1388 S D -1.1105
1389 K D -2.1692
1390 A D -1.6922
1391 D D -2.1844
1392 Y D 0.0000
1393 E D -3.5661
1394 K D -3.4839
1395 H D -3.0513
1396 K D -3.2018
1397 V D -2.1686
1398 Y D 0.0000
1399 A D -0.7490
1400 C D 0.0000
1401 E D -0.8965
1402 V D 0.0000
1403 T D -1.2148
1404 H D 0.0000
1405 Q D -1.6647
1406 G D -0.4482
1407 L D -0.2137
1408 S D -0.4812
1409 S D -0.6510
1410 P D -0.5460
1411 V D -0.1961
1412 T D -0.5902
1413 K D -0.8860
1414 S D -0.7864
1415 F D -1.0368
1416 N D -2.1747
1417 R D -2.5141
1418 G D -2.2621
1419 E D -2.1007
1420 C D -0.7597

 

Laboratory of Theory of Biopolymers 2015