Project name: HmuO

Status: done

submitted: 2017-05-19 17:24:39, status changed: 2017-05-19 17:47:23
Settings
Chain sequence(s) A: GLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTRLQEQAWLFYTALEQAVDAVRASGFAESLLDPALNRAEVLARDLDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPALVAHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGFYHFEGIAKLKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFNHQVFADLGK
C: GLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTRLQEQAWLFYTALEQAVDAVRASGFAESLLDPALNRAEVLARDLDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPALVAHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGFYHFEGIAKLKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFNHQVFADLGK
B: GLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTRLQEQAWLFYTALEQAVDAVRASGFAESLLDPALNRAEVLARDLDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPALVAHHYVRYLGDLSSGGGQVIARMMQRHYGVDPEALGFYHFEGIAKLKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFNHQVFADLGKGL
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2912
Maximal score value
1.1608
Average score
-1.0958
Total score value
-682.6829

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 G A -1.0110
8 L A 0.0000
9 A A -1.3692
10 V A 0.0156
11 E A -1.0995
12 L A 0.0000
13 K A -2.1599
14 Q A -2.1473
15 S A -1.7116
16 T A 0.0000
17 A A -2.4831
18 Q A -3.0042
19 A A -2.6766
20 H A -3.3517
21 E A -4.0157
22 K A -3.8747
23 A A -2.9038
24 E A -3.5805
25 H A -2.9998
26 S A 0.0000
27 T A -0.8808
28 F A 0.0000
29 M A 0.0000
30 S A -1.5392
31 D A -1.6372
32 L A 0.0000
33 L A -1.3734
34 K A -2.2948
35 G A -1.9781
36 R A -2.3428
37 L A -0.8163
38 G A -0.2134
39 V A 0.4633
40 A A -0.1370
41 E A -0.7556
42 F A 0.0000
43 T A 0.0000
44 R A -1.6912
45 L A 0.0000
46 Q A 0.0000
47 E A 0.0000
48 Q A 0.0000
49 A A 0.0000
50 W A -0.2643
51 L A 0.3377
52 F A 0.0000
53 Y A 0.0000
54 T A -0.3180
55 A A 0.0000
56 L A 0.0000
57 E A 0.0000
58 Q A -1.6377
59 A A 0.0000
60 V A 0.0000
61 D A -2.3688
62 A A -1.2443
63 V A 0.0000
64 R A -1.6822
65 A A -0.9363
66 S A -0.7572
67 G A -1.0114
68 F A -0.7609
69 A A -1.4804
70 E A -2.4288
71 S A -1.4072
72 L A 0.0000
73 L A 0.0000
74 D A -1.2185
75 P A -1.0608
76 A A -0.7662
77 L A 0.0000
78 N A -0.8109
79 R A 0.0000
80 A A 0.0000
81 E A -2.2180
82 V A -1.7438
83 L A 0.0000
84 A A -2.0433
85 R A -3.0785
86 D A 0.0000
87 L A 0.0000
88 D A -2.8633
89 K A -3.1484
90 L A -1.8035
91 N A -1.6665
92 G A -1.7167
93 S A -2.0504
94 S A -2.5911
95 E A -3.1819
96 W A 0.0000
97 R A -3.0872
98 S A -2.4597
99 R A -2.8255
100 I A -1.7300
101 T A -0.5631
102 A A 0.2830
103 S A 0.0711
104 P A -0.1222
105 A A 0.0000
106 V A 0.0000
107 I A 0.4118
108 D A -0.2593
109 Y A 0.0000
110 V A -0.0123
111 N A -0.4995
112 R A -0.9227
113 L A 0.0000
114 E A -1.3192
115 E A -1.1474
116 I A 0.0000
117 R A -1.3341
118 D A -1.4495
119 N A -0.9051
120 V A -0.0620
121 D A -0.2622
122 G A 0.0000
123 P A 0.0000
124 A A 0.0000
125 L A 0.0000
126 V A 0.0000
127 A A 0.0000
128 H A 0.0000
129 H A 0.0000
130 Y A -0.3232
131 V A 0.0000
132 R A -0.3041
133 Y A 0.0000
134 L A 0.0000
135 G A -0.5632
136 D A 0.0000
137 L A 0.0000
138 S A -0.4375
139 G A -0.0203
140 G A 0.0000
141 Q A -0.5600
142 V A 0.4745
143 I A -0.0052
144 A A -1.2386
145 R A -2.1709
146 M A -1.6195
147 M A 0.0000
148 Q A -2.7621
149 R A -3.0070
150 H A -2.0693
151 Y A -1.1828
152 G A -1.8218
153 V A 0.0000
154 D A -3.1298
155 P A -2.5094
156 E A -3.0931
157 A A 0.0000
158 L A 0.0000
159 G A -1.8476
160 F A 0.0000
161 Y A -0.7758
162 H A -1.8079
163 F A 0.0000
164 E A -2.2237
165 G A -1.5216
166 I A -1.0039
167 A A -0.9961
168 K A -1.6580
169 L A -1.1612
170 K A -2.0154
171 V A -1.1482
172 Y A -1.4648
173 K A -2.1149
174 D A -2.6655
175 E A -3.4348
176 Y A 0.0000
177 R A -3.1807
178 E A -4.2752
179 K A -3.4654
180 L A 0.0000
181 N A -3.2118
182 N A -3.0551
183 L A -1.9840
184 E A -2.1523
185 L A -2.1146
186 S A -2.3644
187 D A -3.4482
188 E A -3.6462
189 Q A -3.1172
190 R A -3.1207
191 E A -3.5766
192 H A -2.7080
193 L A 0.0000
194 L A -2.0589
195 K A -2.4136
196 E A 0.0000
197 A A 0.0000
198 T A -0.8458
199 D A -0.7859
200 A A 0.0000
201 F A -0.3396
202 V A -0.0554
203 F A 0.0000
204 N A 0.0000
205 H A -0.8950
206 Q A -0.2168
207 V A 0.0000
208 F A -0.3276
209 A A -0.6673
210 D A -0.9652
211 L A -1.1074
212 G A -1.3452
213 K A -1.9148
307 G B -0.9519
308 L B 0.0000
309 A B 0.0000
310 V B 0.0109
311 E B -1.2563
312 L B 0.0000
313 K B -2.2653
314 Q B -2.2441
315 S B -1.8064
316 T B 0.0000
317 A B -2.5876
318 Q B -2.9005
319 A B -2.3859
320 H B -3.2238
321 E B -4.1045
322 K B -3.6861
323 A B 0.0000
324 E B -3.1484
325 H B -2.9704
326 S B -2.1052
327 T B -1.0181
328 F B 0.0000
329 M B 0.0000
330 S B -1.6113
331 D B -2.0456
332 L B 0.0000
333 L B -1.3607
334 K B -2.2172
335 G B -2.0341
336 R B -2.4034
337 L B -0.9206
338 G B -0.2723
339 V B 0.3307
340 A B -0.0819
341 E B -0.7465
342 F B 0.0000
343 T B 0.0000
344 R B -0.9887
345 L B 0.0000
346 Q B 0.0000
347 E B 0.0000
348 Q B 0.0000
349 A B 0.0000
350 W B 0.0000
351 L B 0.0000
352 F B 0.0000
353 Y B 0.0000
354 T B -0.4476
355 A B 0.0000
356 L B 0.0000
357 E B 0.0000
358 Q B -1.4075
359 A B 0.0000
360 V B 0.0000
361 D B -2.2015
362 A B -1.3788
363 V B 0.0000
364 R B -1.6288
365 A B -0.9248
366 S B -0.7568
367 G B -1.0469
368 F B -0.7533
369 A B -1.4648
370 E B -2.4332
371 S B -1.3952
372 L B 0.0000
373 L B 0.0000
374 D B -1.1974
375 P B -1.0271
376 A B -0.6801
377 L B 0.0000
378 N B -0.6718
379 R B 0.0000
380 A B -1.0053
381 E B -2.1042
382 V B -1.2628
383 L B 0.0000
384 A B -1.6423
385 R B -2.8907
386 D B 0.0000
387 L B 0.0000
388 D B -2.1674
389 K B -3.0295
390 L B -1.7327
391 N B -1.3901
392 G B -1.5079
393 S B -1.5333
394 S B -1.9367
395 E B -2.4246
396 W B 0.0000
397 R B 0.0000
398 S B -1.9040
399 R B -2.6197
400 I B 0.0000
401 T B -0.7585
402 A B 0.0000
403 S B 0.0000
404 P B -0.2678
405 A B 0.0000
406 V B 0.0000
407 I B -0.4300
408 D B -1.9890
409 Y B 0.0000
410 V B 0.0000
411 N B -2.3099
412 R B -2.1133
413 L B 0.0000
414 E B -2.3964
415 E B -2.7598
416 I B 0.0000
417 R B -2.2326
418 D B -2.8841
419 N B -2.2263
420 V B -0.8804
421 D B -0.8719
422 G B 0.0000
423 P B -0.5571
424 A B 0.0000
425 L B 0.0000
426 V B 0.0000
427 A B 0.0000
428 H B 0.0000
429 H B 0.0000
430 Y B 0.0000
431 V B 0.0000
432 R B -0.3206
433 Y B 0.0000
434 L B 0.0000
435 G B -0.4404
436 D B 0.0000
437 L B 0.0000
438 S B -0.2080
439 G B 0.1461
440 G B 0.0000
441 Q B 0.1903
442 V B 1.1608
443 I B 0.7484
444 A B 0.0000
445 R B -0.7629
446 M B -0.7532
447 M B 0.0000
448 Q B -2.0024
449 R B -2.8144
450 H B -2.0697
451 Y B -1.1878
452 G B -1.6094
453 V B 0.0000
454 D B -3.0233
455 P B -2.1938
456 E B -3.0274
457 A B 0.0000
458 L B 0.0000
459 G B -1.5549
460 F B 0.0000
461 Y B 0.0000
462 H B -1.0121
463 F B 0.0000
464 E B -2.0551
465 G B -1.3031
466 I B -0.6960
467 A B -0.6291
468 K B -0.3852
469 L B -0.6656
470 K B -1.2698
471 V B -1.2151
472 Y B -1.4354
473 K B -2.2510
474 D B -3.5429
475 E B -3.7987
476 Y B 0.0000
477 R B -3.1327
478 E B -4.2756
479 K B -3.5631
480 L B 0.0000
481 N B -2.9167
482 N B -2.9193
483 L B -1.9779
484 E B -2.4112
485 L B -2.1371
486 S B -2.4144
487 D B -3.6857
488 E B -3.7712
489 Q B -3.2019
490 R B -3.2674
491 E B -3.8480
492 H B -2.8617
493 L B 0.0000
494 L B -2.1438
495 K B -2.6887
496 E B 0.0000
497 A B 0.0000
498 T B -0.9532
499 D B -1.0764
500 A B 0.0000
501 F B 0.0000
502 V B 0.7507
503 F B 0.0053
504 N B 0.0000
505 H B -0.9025
506 Q B -0.9366
507 V B 0.0000
508 F B -0.6074
509 A B -0.8196
510 D B 0.0000
511 L B 0.0000
512 G B -1.4242
513 K B -1.7080
514 G B -0.9594
515 L B 0.3565
607 G C -0.7606
608 L C 0.0000
609 A C 0.0000
610 V C 0.1981
611 E C -0.9011
612 L C 0.0000
613 K C -2.1042
614 Q C -2.1099
615 S C -1.7000
616 T C 0.0000
617 A C -2.5391
618 Q C -3.0695
619 A C -2.7014
620 H C -3.3820
621 E C -4.2912
622 K C -3.9281
623 A C -3.0241
624 E C -3.8077
625 H C -3.1038
626 S C -2.0956
627 T C -0.9063
628 F C 0.0000
629 M C 0.0000
630 S C -1.4922
631 D C -1.5185
632 L C 0.0000
633 L C -1.2001
634 K C -2.4210
635 G C -1.9563
636 R C -2.2742
637 L C -0.8011
638 G C -0.3368
639 V C 0.2394
640 A C -0.2223
641 E C -0.8431
642 F C 0.0000
643 T C -0.9089
644 R C -1.7774
645 L C 0.0000
646 Q C 0.0000
647 E C -1.0812
648 Q C 0.0000
649 A C 0.0000
650 W C 0.0000
651 L C 0.0000
652 F C 0.0000
653 Y C 0.0000
654 T C -0.3247
655 A C 0.0000
656 L C 0.0000
657 E C 0.0000
658 Q C -1.4588
659 A C 0.0000
660 V C 0.0000
661 D C -2.1869
662 A C -1.4414
663 V C 0.0000
664 R C -1.6338
665 A C -1.1131
666 S C -0.7546
667 G C -1.0413
668 F C -0.7412
669 A C -1.4359
670 E C -2.4189
671 S C -1.3584
672 L C 0.0000
673 L C 0.0000
674 D C -1.0241
675 P C -1.0277
676 A C -0.7416
677 L C 0.0000
678 N C -0.6266
679 R C 0.0000
680 A C -0.9180
681 E C -1.8938
682 V C -1.2349
683 L C 0.0000
684 A C 0.0000
685 R C -2.7049
686 D C 0.0000
687 L C 0.0000
688 D C 0.0000
689 K C -2.8733
690 L C -1.6284
691 N C -1.7551
692 G C -1.7030
693 S C -1.8875
694 S C 0.0000
695 E C -1.5253
696 W C 0.0000
697 R C 0.0000
698 S C 0.0000
699 R C -2.3489
700 I C 0.0000
701 T C -1.3778
702 A C -0.7127
703 S C -0.4478
704 P C -0.7041
705 A C 0.0000
706 V C 0.0000
707 I C -0.9121
708 D C -2.1649
709 Y C 0.0000
710 V C 0.0000
711 N C -2.5346
712 R C -2.2024
713 L C 0.0000
714 E C -2.4099
715 E C -2.8649
716 I C 0.0000
717 R C -2.4706
718 D C -2.9401
719 N C -2.3067
720 V C -0.9731
721 D C -0.9296
722 G C 0.0000
723 P C 0.0000
724 A C 0.0000
725 L C 0.0000
726 V C 0.0000
727 A C 0.0000
728 H C 0.0000
729 H C 0.0000
730 Y C -0.2556
731 V C 0.0000
732 R C -0.2748
733 Y C 0.0000
734 L C 0.0000
735 G C -0.3966
736 D C 0.0000
737 L C 0.0000
738 S C -0.3723
739 G C 0.0982
740 G C 0.0000
741 Q C -0.3233
742 V C 0.9323
743 I C 0.3075
744 A C 0.0000
745 R C -1.7206
746 M C -1.2484
747 M C 0.0000
748 Q C -2.3794
749 R C -2.9305
750 H C -1.9503
751 Y C -1.1427
752 G C -1.6952
753 V C 0.0000
754 D C -3.0491
755 P C -2.4292
756 E C -3.0276
757 A C 0.0000
758 L C 0.0000
759 G C -1.7558
760 F C 0.0000
761 Y C 0.0000
762 H C -1.5243
763 F C 0.0000
764 E C -2.2142
765 G C -1.5667
766 I C -1.0840
767 A C -1.1281
768 K C -1.5684
769 L C -1.0368
770 K C -1.9683
771 V C -1.1022
772 Y C -1.4696
773 K C -2.0591
774 D C -2.6228
775 E C -3.2440
776 Y C 0.0000
777 R C -2.6454
778 E C -3.8918
779 K C -3.2530
780 L C 0.0000
781 N C -2.6415
782 N C -2.7893
783 L C -2.0036
784 E C -2.4037
785 L C -2.1578
786 S C -2.4231
787 D C -3.6824
788 E C -3.7387
789 Q C -3.1491
790 R C -3.1698
791 E C -3.7925
792 H C -2.8181
793 L C 0.0000
794 L C -2.1672
795 K C -2.6276
796 E C 0.0000
797 A C 0.0000
798 T C -1.0077
799 D C -1.1349
800 A C 0.0000
801 F C 0.0000
802 V C 0.4388
803 F C -0.1425
804 N C 0.0000
805 H C -0.8104
806 Q C -1.1110
807 V C 0.0000
808 F C -0.6192
809 A C -1.0789
810 D C -1.3894
811 L C -1.2804
812 G C -1.5055
813 K C -1.9719

 

Laboratory of Theory of Biopolymers 2015