Project name: 3rdv_modified_chains-AE.pdb_stat_DIBS

Status: done

submitted: 2018-04-18 14:34:17, status changed: 2018-04-20 13:31:05
Settings
Chain sequence(s) A: DFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTR
E: DSWKDGCY
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.5582
Maximal score value
0.2525
Average score
-0.9914
Total score value
-77.3288

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
57 D A -2.2578
58 F A -1.7290
59 R A -1.9838
60 V A -0.1273
61 G A -0.4271
62 E A -1.1208
63 R A -0.8550
64 V A 0.0000
65 W A -1.2684
66 V A 0.0000
67 N A -2.0381
68 G A -1.9799
69 N A -1.8147
70 K A -1.4875
71 P A -1.1538
72 G A 0.0000
73 F A 0.2525
74 I A 0.0000
75 Q A -0.2817
76 F A -0.0438
77 L A -0.4469
78 G A -1.2035
79 E A -2.5582
80 T A -1.7183
81 Q A -1.3788
82 F A -0.4159
83 A A -0.7885
84 P A -1.2805
85 G A -1.8754
86 Q A -2.2678
87 W A 0.0000
88 A A 0.0000
89 G A 0.0000
90 I A 0.0000
91 V A -0.5057
92 L A 0.0000
93 D A -1.7610
94 E A -2.0886
95 P A -1.2819
96 I A -0.5689
97 G A 0.0000
98 K A -0.7398
99 N A -0.7732
100 D A -1.6244
101 G A 0.0000
102 S A -0.9994
103 V A -0.3442
104 A A -0.2280
105 G A -0.5343
106 V A -0.6107
107 R A -1.5444
108 Y A -1.0486
109 F A 0.0000
110 Q A -1.9989
111 C A -1.5029
112 E A -2.1240
113 P A -1.1805
114 L A -0.2261
115 K A -1.4514
116 G A 0.0000
117 I A 0.0000
118 F A 0.0000
119 T A 0.0000
120 R A -1.6037
121 P A -1.3713
122 S A -1.4695
123 K A -2.2737
124 L A 0.0000
125 T A -1.7234
126 R A -2.2713
574 D E -2.1697
575 S E -1.7279
576 W E -1.4337
577 K E -1.8993
578 D E -2.4169
579 G E -1.4025
580 C E 0.0000
581 Y E -0.1790

 

Laboratory of Theory of Biopolymers 2015