Project name: ZEDIII 5kvg [mutate: VE303A, LE300A]

Chain sequence(s)	E: MRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VE303A, LE300A
Energy difference between WT (input) and mutated protein (by FoldX)	-0.0764266 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.1517
• Maximal score value: 1.0062
• Average score: -0.5998
• Total score value: -64.7776

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
298	M	E	0.1571
299	R	E	-1.6965
300	A	E	-1.0928	mutated: LE300A
301	K	E	-1.5729
302	G	E	0.0000
303	A	E	-0.5748	mutated: VE303A
304	S	E	-0.6358
305	Y	E	-0.3009
306	S	E	-0.2720
307	L	E	0.2680
308	C	E	0.0000
309	T	E	-0.5855
310	A	E	-0.6666
311	A	E	-0.9286
312	F	E	0.0000
313	T	E	-0.6812
314	F	E	0.0374
315	T	E	-0.5627
316	K	E	-0.6531
317	I	E	1.0062
318	P	E	0.0000
319	A	E	-0.4973
320	E	E	-1.5447
321	T	E	-0.5952
322	L	E	0.6094
323	H	E	-0.6391
324	G	E	-0.6601
325	T	E	-0.9103
326	V	E	0.0000
327	T	E	-0.3211
328	V	E	0.0000
329	E	E	-0.4694
330	V	E	0.0000
331	Q	E	-1.5068
332	Y	E	0.0000
333	A	E	-1.4673
334	G	E	-1.4724
335	T	E	-1.7135
336	D	E	-1.5659
337	G	E	0.0000
338	P	E	-0.9970
339	C	E	0.0000
340	K	E	-0.5063
341	V	E	0.0000
342	P	E	0.0000
343	A	E	-0.2141
344	Q	E	-0.4485
345	M	E	0.0000
346	A	E	0.0000
347	V	E	0.9070
348	D	E	-0.3303
349	M	E	-0.0077
350	Q	E	-1.0430
351	T	E	-0.5243
352	L	E	0.0684
353	T	E	-0.0287
354	P	E	-0.3898
355	V	E	-0.0497
356	G	E	-0.7735
357	R	E	-1.7600
358	L	E	-0.2082
359	I	E	0.5873
360	T	E	0.3260
361	A	E	-0.0340
362	N	E	-0.6480
363	P	E	0.0000
364	V	E	0.0000
365	I	E	0.0000
366	T	E	-1.1496
367	E	E	-2.3451
368	S	E	-1.8463
369	T	E	-1.9652
370	E	E	-3.1517
371	N	E	-2.8528
372	S	E	-2.4180
373	K	E	-2.3309
374	M	E	-0.6932
375	M	E	-0.1048
376	L	E	0.0000
377	E	E	-0.5179
378	L	E	0.0000
379	D	E	-0.9231
380	P	E	0.0000
381	P	E	-0.1000
382	F	E	0.4089
383	G	E	-0.6354
384	D	E	-1.6240
385	S	E	0.0000
386	Y	E	0.1739
387	I	E	0.0000
388	V	E	0.0000
389	I	E	0.0000
390	G	E	0.0000
391	V	E	-0.1379
392	G	E	-1.4979
393	E	E	-2.6989
394	K	E	-2.5252
395	K	E	-1.5583
396	I	E	-0.4351
397	T	E	-0.1838
398	H	E	-0.0045
399	H	E	-0.8225
400	W	E	-1.0051
401	H	E	-1.6658
402	R	E	-1.1577
403	S	E	-0.7380
404	G	E	-0.4890
405	S	E	-0.1999