Project name: f17bc4dc32bc31d

Status: done

submitted: 2017-11-14 10:16:09, status changed: 2017-11-14 11:39:34
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYLVLYLIIGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYLVLYLIIGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGAVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVILYDGSDKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVAVAGTHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVESGGGAVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVILYDGSDKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVAVAGTHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.8425
Maximal score value
2.6024
Average score
-0.753
Total score value
-997.0103

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.1198
2 I A 0.8882
3 Q A 0.0000
4 M A 0.6435
5 T A 0.0000
6 Q A -1.0565
7 S A -0.6886
8 P A -0.7674
9 S A -0.8236
10 S A -0.8323
11 L A -0.5096
12 S A -0.8845
13 A A 0.0000
14 S A -0.8296
15 V A 0.2298
16 G A -0.7066
17 D A -1.6074
18 R A -2.2937
19 V A 0.0000
20 T A -0.6940
21 I A 0.0000
22 T A -0.6470
23 C A 0.0000
24 R A -1.1672
25 A A 0.0000
26 S A -0.8074
27 Q A -2.0042
28 G A -2.3337
29 I A 0.0000
30 R A -2.3869
31 N A -1.1373
32 D A -0.7682
33 L A 0.0000
34 G A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.0883
39 K A -1.4742
40 P A -1.5687
41 G A -1.6395
42 K A -2.4828
43 A A -1.5361
44 P A 0.0000
45 K A -0.6740
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 1.4952
50 L A 1.3223
51 V A 1.1721
52 L A 1.7993
53 Y A 2.6024
54 L A 2.1775
55 I A 2.0535
56 I A 2.3419
57 G A 0.7806
58 V A 0.8368
59 P A 0.0270
60 S A -0.3325
61 R A -0.6889
62 F A 0.0000
63 S A 0.2748
64 G A 0.0000
65 S A 0.2010
66 G A -0.6931
67 S A -1.1726
68 G A -1.8020
69 T A -1.7028
70 D A -1.6001
71 F A 0.0000
72 T A -0.4293
73 L A 0.0000
74 T A -0.5498
75 I A 0.0000
76 S A -1.3165
77 S A -1.0856
78 L A 0.0000
79 Q A -0.7453
80 P A -1.1686
81 E A -1.5063
82 D A 0.0000
83 F A -0.8294
84 A A 0.0000
85 T A -0.6922
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 L A -0.2127
92 N A -1.3505
93 S A -0.4694
94 Y A 0.5094
95 P A 0.0026
96 P A 0.0000
97 T A -0.0040
98 F A 0.0000
99 G A 0.0000
100 G A -0.7428
101 G A -0.9438
102 T A 0.0000
103 K A -1.1924
104 V A 0.0000
105 E A -1.1811
106 I A 0.0000
107 K A -1.3938
108 R A -1.8542
109 T A -0.3645
110 V A 0.8999
111 A A 0.2991
112 A A 0.1085
113 P A -0.1170
114 S A -0.2911
115 V A 0.0000
116 F A 0.1752
117 I A 0.0000
118 F A 0.0000
119 P A -0.4958
120 P A 0.0000
121 S A 0.0000
122 D A -2.7218
123 E A -2.0834
124 Q A 0.0000
125 L A 0.0000
126 K A -2.8134
127 S A -1.5790
128 G A -1.0924
129 T A -0.7389
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -1.0752
139 F A 0.0000
140 Y A 0.0000
141 P A -1.7899
142 R A -3.3046
143 E A -3.3106
144 A A -2.5699
145 K A -2.5929
146 V A -1.6428
147 Q A -1.4319
148 W A 0.0000
149 K A -0.9248
150 V A 0.0000
151 D A -1.7931
152 N A -1.4397
153 A A -0.6442
154 L A -0.2306
155 Q A -1.3861
156 S A -1.0861
157 G A -1.3453
158 N A -1.9991
159 S A -1.6095
160 Q A -1.4077
161 E A -1.8912
162 S A 0.0000
163 V A -0.8441
164 T A -1.1907
165 E A -2.2400
166 Q A 0.0000
167 D A -2.1375
168 S A -2.0485
169 K A -2.4633
170 D A -2.3573
171 S A -2.2896
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A 0.0000
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5057
181 L A -0.5191
182 S A -0.8240
183 K A -1.4547
184 A A -1.4062
185 D A -1.6609
186 Y A 0.0000
187 E A -2.4832
188 K A -2.9749
189 H A -2.6145
190 K A -2.8483
191 V A -1.5192
192 Y A 0.0000
193 A A -1.1310
194 C A 0.0000
195 E A -1.1477
196 V A 0.0000
197 T A -1.2142
198 H A 0.0000
199 Q A -1.7440
200 G A -0.3806
201 L A -0.0563
202 S A -0.3977
203 S A -0.3313
204 P A -0.4961
205 V A -0.0754
206 T A -0.6295
207 K A -1.0079
208 S A -0.8712
209 F A 0.0000
210 N A -2.0732
211 R A -2.2127
212 G A -1.5511
213 E A -1.8620
214 C A -1.6675
215 Q B -1.1207
216 V B -0.5991
217 Q B -1.1037
218 L B 0.0000
219 V B -0.1669
220 E B -0.3208
221 S B -0.7044
222 G B -0.9614
223 G B -0.7658
224 G B -0.3808
225 A B -0.4610
226 V B 0.0000
227 Q B -2.0028
228 P B -2.2396
229 G B -2.3629
230 R B -2.8014
231 S B -2.1169
232 L B -1.5797
233 R B -2.1255
234 L B 0.0000
235 S B -0.7060
236 C B 0.0000
237 A B -0.4164
238 A B -0.5048
239 S B -0.7303
240 G B -0.4855
241 F B 0.0257
242 T B -0.0484
243 F B 0.0000
244 S B -0.7249
245 S B -0.0747
246 Y B 0.4760
247 G B 0.0000
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -0.9389
254 A B 0.0000
255 P B -1.0859
256 G B -1.4971
257 K B -2.3697
258 G B -1.5777
259 L B -1.0384
260 E B -1.3619
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.0000
265 I B 0.0000
266 L B -0.2163
267 Y B -0.3216
268 D B -1.7526
269 G B -1.4329
270 S B -1.2116
271 D B -1.3792
272 K B -0.7358
273 F B 0.5051
274 Y B -0.2235
275 A B -1.0624
276 D B -2.6510
277 S B -2.2212
278 V B 0.0000
279 K B -2.8726
280 G B -2.3633
281 R B -3.1546
282 F B 0.0000
283 T B -1.3362
284 I B 0.0000
285 S B -0.7544
286 R B -1.0222
287 D B -1.6664
288 N B -1.7051
289 S B -1.5698
290 K B -2.3751
291 N B -1.7517
292 T B 0.0000
293 L B 0.0000
294 Y B -0.5743
295 L B 0.0000
296 Q B -1.6046
297 M B 0.0000
298 N B -2.3210
299 S B -2.1231
300 L B 0.0000
301 R B -3.2488
302 A B -2.0463
303 E B -2.4784
304 D B 0.0000
305 T B -0.8224
306 A B 0.0000
307 V B 0.2860
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 V B 0.6992
314 A B 0.4301
315 V B 0.5991
316 A B 0.0000
317 G B 0.0000
318 T B 0.0000
319 H B -0.7344
320 F B -0.0372
321 D B 0.1234
322 Y B -0.0694
323 W B 0.0000
324 G B 0.0000
325 Q B -1.6048
326 G B -0.7355
327 T B -0.1636
328 L B 0.1522
329 V B 0.0000
330 T B -0.4183
331 V B 0.0000
332 S B -1.0243
333 S B -0.7295
334 A B -0.7018
335 S B -0.9837
336 T B -1.4136
337 K B -2.3809
338 G B -2.0456
339 P B -1.2146
340 S B -0.7285
341 V B 0.0000
342 F B 0.0000
343 P B -1.0679
344 L B 0.0000
345 A B -0.9985
346 P B -0.7963
347 S B -1.2389
348 S B -1.4340
349 K B -2.0480
350 S B -1.4774
351 T B -0.9503
352 S B -0.9781
353 G B -0.7735
354 G B -0.7043
355 T B -0.5208
356 A B 0.0000
357 A B 0.0358
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.7029
364 D B -1.6862
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -1.0035
369 P B -0.8519
370 V B -0.5589
371 T B -0.5641
372 V B -0.3093
373 S B -0.3183
374 W B 0.0000
375 N B -0.9404
376 S B -0.6922
377 G B -0.3849
378 A B -0.2183
379 L B -0.0088
380 T B -0.1101
381 S B -0.1129
382 G B -0.1427
383 V B 0.3476
384 H B -0.0634
385 T B 0.0422
386 F B 0.0000
387 P B -0.3668
388 A B 0.1554
389 V B 0.2106
390 L B 0.1970
391 Q B -0.8523
392 S B -0.5985
393 S B -0.4244
394 G B -0.9236
395 L B -0.8198
396 Y B -0.4980
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0669
404 V B 0.0000
405 P B -0.5681
406 S B -0.5962
407 S B -0.6697
408 S B -0.7827
409 L B -0.9124
410 G B -1.1825
411 T B -0.9222
412 Q B -1.3828
413 T B -1.3703
414 Y B 0.0000
415 I B -1.4042
416 C B 0.0000
417 N B -1.5353
418 V B 0.0000
419 N B -1.9453
420 H B 0.0000
421 K B -2.7443
422 P B -1.8649
423 S B -2.0550
424 N B -2.5480
425 T B -2.1370
426 K B -2.5978
427 V B -1.7147
428 D B -2.5993
429 K B -2.2268
430 R B -2.8608
431 V B 0.0000
432 E B -2.9365
433 P B -2.2838
434 K B -2.7611
435 S B -1.8893
436 C B -1.7741
437 D B -1.9574
438 K B -2.5671
439 T B -2.1682
440 H B -2.1719
441 T B -1.6953
442 C B 0.0000
443 P B -0.8249
444 P B -0.3485
445 C B -0.1567
446 P B -0.4965
447 A B -0.5690
448 P B -0.7245
449 E B -1.0573
450 L B 0.5356
451 L B 1.3657
452 G B 0.2888
453 G B -0.1343
454 P B 0.0000
455 S B -0.0116
456 V B 0.0000
457 F B 1.1428
458 L B 0.0000
459 F B 1.2870
460 P B 0.0068
461 P B 0.0000
462 K B -2.1561
463 P B -1.4685
464 K B -1.4759
465 D B -1.5213
466 T B 0.0000
467 L B 0.0000
468 M B 0.3786
469 I B 1.4995
470 S B -0.0831
471 R B -1.4094
472 T B -0.7490
473 P B 0.0000
474 E B -1.0374
475 V B 0.0000
476 T B 0.6700
477 C B 0.0000
478 V B 0.2777
479 V B 0.0000
480 V B -0.2947
481 D B -0.9333
482 V B 0.0000
483 S B -1.8245
484 H B -2.2158
485 E B -2.7155
486 D B 0.0000
487 P B -2.2009
488 E B -2.5642
489 V B 0.0000
490 K B -2.4761
491 F B -2.0136
492 N B -1.4708
493 W B 0.0000
494 Y B -0.9145
495 V B -0.7152
496 D B -1.9695
497 G B -0.6185
498 V B 1.0095
499 E B -0.0519
500 V B 0.5087
501 H B -1.0903
502 N B -1.2055
503 A B -1.2095
504 K B -2.3769
505 T B 0.0000
506 K B -3.2273
507 P B -2.4424
508 R B -3.4648
509 E B -3.4258
510 E B -2.8519
511 Q B -2.3576
512 Y B -1.1472
513 N B -1.3587
514 S B -1.2408
515 T B -1.4764
516 Y B -2.0765
517 R B -1.7391
518 V B 0.0000
519 V B -0.9834
520 S B 0.0000
521 V B -0.1879
522 L B 0.0000
523 T B -0.3073
524 V B 0.5324
525 L B 1.2158
526 H B 0.0000
527 Q B -0.8275
528 D B -0.7682
529 W B 0.0000
530 L B -0.7455
531 N B -1.8369
532 G B -1.9244
533 K B -2.0166
534 E B -2.1817
535 Y B 0.0000
536 K B -1.7945
537 C B 0.0000
538 K B -1.7890
539 V B 0.0000
540 S B -1.4027
541 N B -1.7352
542 K B -2.0880
543 A B -1.2735
544 L B 0.0000
545 P B -0.4899
546 A B -0.3834
547 P B -0.5083
548 I B -0.5047
549 E B -1.5487
550 K B -1.4004
551 T B -1.1512
552 I B -0.0231
553 S B -1.4002
554 K B -1.3548
555 A B -1.2957
556 K B -2.3195
557 G B -2.0784
558 Q B -2.1318
559 P B -2.2162
560 R B -2.6352
561 E B -2.7232
562 P B 0.0000
563 Q B -1.2912
564 V B 0.0000
565 Y B 0.0000
566 T B 0.0000
567 L B 0.0000
568 P B -0.3795
569 P B -0.6960
570 S B -1.1306
571 R B -2.1803
572 E B -2.0312
573 E B 0.0000
574 M B -1.0054
575 T B -1.3025
576 K B -2.3456
577 N B -2.6889
578 Q B -2.4749
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B 0.0000
587 G B -1.0283
588 F B 0.0000
589 Y B -1.3069
590 P B 0.0000
591 S B -0.0969
592 D B -1.0867
593 I B -0.6874
594 A B -0.5605
595 V B -0.5600
596 E B -1.4323
597 W B 0.0000
598 E B -1.8113
599 S B 0.0000
600 N B -2.0092
601 G B -1.8034
602 Q B -2.1373
603 P B -1.9189
604 E B -2.1064
605 N B -2.2483
606 N B -2.0940
607 Y B -1.3567
608 K B -1.1334
609 T B -0.5982
610 T B 0.0000
611 P B -0.0516
612 P B 0.2192
613 V B 0.6425
614 L B 0.7807
615 D B -0.4460
616 S B -1.3442
617 D B -1.9584
618 G B -0.8204
619 S B 0.0000
620 F B 0.1775
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -1.1138
628 V B 0.0000
629 D B -2.7800
630 K B -2.7561
631 S B -2.2792
632 R B -2.3842
633 W B 0.0000
634 Q B -2.5920
635 Q B -2.4515
636 G B -1.6838
637 N B -1.4529
638 V B -0.6466
639 F B 0.0000
640 S B -1.1106
641 C B 0.0000
642 S B 0.0000
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.2291
647 A B -1.8347
648 L B 0.0000
649 H B -1.8467
650 N B -1.7530
651 H B -1.3003
652 Y B -0.6895
653 T B -1.1551
654 Q B -1.5025
655 K B -1.2515
656 S B -0.6425
657 L B -0.1371
658 S B -0.4869
659 L B 0.0000
660 S B -0.6921
661 P B -0.5961
662 G B -1.0960
663 D C -1.1402
664 I C 0.6942
665 Q C 0.0000
666 M C 0.1106
667 T C 0.0000
668 Q C -1.3244
669 S C -0.7440
670 P C -0.8028
671 S C -0.8290
672 S C -0.7850
673 L C -0.5847
674 S C -1.0077
675 A C 0.0000
676 S C -1.3126
677 V C -0.5781
678 G C -1.0359
679 D C -1.7778
680 R C -2.2729
681 V C -0.9801
682 T C -0.6113
683 I C 0.0000
684 T C -0.9267
685 C C 0.0000
686 R C -2.1365
687 A C 0.0000
688 S C -1.1298
689 Q C -2.1556
690 G C -2.4552
691 I C 0.0000
692 R C -2.4274
693 N C -1.1935
694 D C -0.7312
695 L C 0.0000
696 G C 0.0000
697 W C 0.0000
698 Y C 0.0000
699 Q C 0.0000
700 Q C -1.7267
701 K C -2.5081
702 P C -1.8568
703 G C -1.9846
704 K C -2.7646
705 A C -1.8912
706 P C 0.0000
707 K C -1.6045
708 L C -0.1449
709 L C 0.0000
710 I C 0.0000
711 Y C 1.5355
712 L C 1.4627
713 V C 1.3129
714 L C 1.8531
715 Y C 2.5915
716 L C 2.1195
717 I C 1.9384
718 I C 2.3403
719 G C 0.7980
720 V C 0.7512
721 P C -0.1054
722 S C -0.3797
723 R C -0.7223
724 F C 0.0000
725 S C 0.2528
726 G C 0.0000
727 S C 0.1821
728 G C -0.8638
729 S C -1.3508
730 G C -1.9927
731 T C -2.0562
732 D C -2.0696
733 F C 0.0000
734 T C -0.5819
735 L C 0.0000
736 T C -0.4932
737 I C 0.0000
738 S C -1.2398
739 S C -1.1948
740 L C 0.0000
741 Q C -1.0786
742 P C -1.6211
743 E C -2.2701
744 D C 0.0000
745 F C 0.0000
746 A C 0.0000
747 T C -0.8952
748 Y C 0.0000
749 Y C 0.0000
750 C C 0.0000
751 Q C 0.0000
752 Q C 0.0000
753 L C -0.3121
754 N C -1.4346
755 S C -0.4624
756 Y C 0.4975
757 P C -0.0356
758 P C -0.1195
759 T C -0.0766
760 F C 0.0000
761 G C 0.0000
762 G C -0.7222
763 G C -0.8344
764 T C 0.0000
765 K C -1.2113
766 V C 0.0000
767 E C -1.3188
768 I C 0.0000
769 K C -1.8381
770 R C -2.1096
771 T C -0.3507
772 V C 0.9319
773 A C 0.3871
774 A C 0.1585
775 P C -0.2475
776 S C -0.2492
777 V C 0.0000
778 F C 0.1077
779 I C 0.0000
780 F C 0.0000
781 P C 0.0000
782 P C 0.0000
783 S C -1.6213
784 D C -2.6742
785 E C -2.3197
786 Q C 0.0000
787 L C -1.9981
788 K C -2.5740
789 S C -1.5782
790 G C -1.1377
791 T C -0.8294
792 A C 0.0000
793 S C 0.0000
794 V C 0.0000
795 V C 0.0000
796 C C 0.0000
797 L C 0.0000
798 L C 0.0000
799 N C 0.0000
800 N C -0.9218
801 F C 0.0000
802 Y C -1.1761
803 P C -1.7870
804 R C -3.2094
805 E C -3.2989
806 A C -2.5587
807 K C -2.6887
808 V C 0.0000
809 Q C -0.9765
810 W C 0.0000
811 K C -0.4868
812 V C -0.7080
813 D C -1.3970
814 N C -1.2349
815 A C -0.2578
816 L C 0.4232
817 Q C -0.9912
818 S C -0.8743
819 G C -1.3223
820 N C -1.9464
821 S C -1.5293
822 Q C -1.0232
823 E C -1.5749
824 S C -0.4995
825 V C -0.8113
826 T C -1.2219
827 E C -2.3893
828 Q C 0.0000
829 D C -2.7977
830 S C -2.6121
831 K C -2.9995
832 D C -3.3102
833 S C 0.0000
834 T C -2.0914
835 Y C 0.0000
836 S C 0.0000
837 L C 0.0000
838 S C 0.0000
839 S C 0.0000
840 T C 0.0000
841 L C 0.0000
842 T C -0.5708
843 L C -0.6062
844 S C -1.1799
845 K C -2.1301
846 A C -2.0709
847 D C -2.3692
848 Y C 0.0000
849 E C -3.8425
850 K C -3.5727
851 H C -3.1613
852 K C -3.3668
853 V C -1.5671
854 Y C 0.0000
855 A C -0.8184
856 C C 0.0000
857 E C -0.9543
858 V C 0.0000
859 T C -1.1759
860 H C 0.0000
861 Q C -1.7778
862 G C -0.3899
863 L C -0.1105
864 S C -0.4243
865 S C -0.3452
866 P C -0.4757
867 V C -0.0214
868 T C -0.5006
869 K C -0.8553
870 S C -0.7999
871 F C 0.0000
872 N C -2.2559
873 R C -2.9343
874 G C -2.4430
875 E C -1.7721
876 C C -1.0737
877 Q D -1.2342
878 V D -0.4692
879 Q D -1.1561
880 L D 0.0000
881 V D 0.0262
882 E D 0.0000
883 S D -0.4616
884 G D -0.7665
885 G D -0.4683
886 G D -0.0879
887 A D -0.2640
888 V D -1.0432
889 Q D -2.1390
890 P D -2.2707
891 G D -2.2858
892 R D -2.7833
893 S D -1.9789
894 L D -1.5125
895 R D -1.8977
896 L D 0.0000
897 S D -0.6882
898 C D 0.0000
899 A D -0.3309
900 A D 0.0000
901 S D -0.7919
902 G D -0.6093
903 F D 0.0484
904 T D 0.0629
905 F D 0.0000
906 S D -0.6875
907 S D 0.0423
908 Y D 0.7305
909 G D 0.0000
910 M D 0.0000
911 H D 0.0000
912 W D 0.0000
913 V D 0.0000
914 R D 0.0000
915 Q D -0.8321
916 A D -1.0493
917 P D -0.9735
918 G D -1.2649
919 K D -1.9600
920 G D -1.3653
921 L D -1.0597
922 E D -1.5316
923 W D 0.0000
924 V D 0.0000
925 A D 0.0000
926 V D 0.0000
927 I D 0.0000
928 L D -0.4028
929 Y D -0.2073
930 D D -1.7734
931 G D -1.5211
932 S D -1.1730
933 D D -1.3574
934 K D -1.0140
935 F D 0.1708
936 Y D -0.6115
937 A D -1.3444
938 D D -2.6606
939 S D -2.1859
940 V D 0.0000
941 K D -2.8608
942 G D -2.1616
943 R D -2.6185
944 F D 0.0000
945 T D -1.2368
946 I D 0.0000
947 S D -1.0260
948 R D -1.8377
949 D D -2.0927
950 N D -1.7049
951 S D -1.6017
952 K D -2.4439
953 N D -1.8081
954 T D -1.1970
955 L D 0.0000
956 Y D -0.7283
957 L D 0.0000
958 Q D -1.2995
959 M D 0.0000
960 N D -2.0376
961 S D -1.9696
962 L D 0.0000
963 R D -3.2171
964 A D -2.0586
965 E D -2.4769
966 D D 0.0000
967 T D -0.6738
968 A D 0.0000
969 V D 0.5305
970 Y D 0.0000
971 Y D 0.0000
972 C D 0.0000
973 A D 0.0000
974 K D 0.0000
975 V D 0.7508
976 A D 0.4255
977 V D 0.5154
978 A D 0.0000
979 G D 0.0000
980 T D 0.0000
981 H D -0.6779
982 F D 0.0000
983 D D -0.2487
984 Y D -0.3413
985 W D 0.0000
986 G D 0.0000
987 Q D -1.5047
988 G D -0.4305
989 T D 0.2834
990 L D 1.0902
991 V D 0.0000
992 T D -0.1998
993 V D 0.0000
994 S D -1.0434
995 S D -0.7725
996 A D -0.6560
997 S D -0.8194
998 T D -0.9381
999 K D -1.5504
1000 G D -1.3898
1001 P D -0.5955
1002 S D -0.2655
1003 V D 0.0000
1004 F D -0.5928
1005 P D -1.2357
1006 L D 0.0000
1007 A D 0.0000
1008 P D -0.6746
1009 S D -1.1593
1010 S D -1.2426
1011 K D -2.0304
1012 S D -1.2439
1013 T D -0.9700
1014 S D -0.8798
1015 G D -0.7729
1016 G D -0.7029
1017 T D -0.5028
1018 A D 0.0000
1019 A D 0.0000
1020 L D 0.0000
1021 G D 0.0000
1022 C D 0.0000
1023 L D 0.0000
1024 V D 0.0000
1025 K D 0.0000
1026 D D -0.5300
1027 Y D 0.0000
1028 F D 0.0000
1029 P D 0.0000
1030 E D -0.5233
1031 P D -0.6170
1032 V D -0.5863
1033 T D -0.5048
1034 V D -0.0918
1035 S D -0.2371
1036 W D -0.1966
1037 N D -0.6473
1038 S D -0.5545
1039 G D -0.3936
1040 A D -0.1973
1041 L D -0.0334
1042 T D -0.1486
1043 S D -0.1520
1044 G D -0.2907
1045 V D 0.1941
1046 H D -0.1819
1047 T D 0.0140
1048 F D 0.0000
1049 P D -0.2100
1050 A D 0.3287
1051 V D 0.7887
1052 L D 1.3371
1053 Q D -0.0262
1054 S D -0.1775
1055 S D -0.3896
1056 G D -0.0582
1057 L D 0.0519
1058 Y D 0.0000
1059 S D 0.0000
1060 L D 0.2068
1061 S D 0.0000
1062 S D 0.0000
1063 V D 0.0000
1064 V D 0.0000
1065 T D -0.1008
1066 V D 0.0000
1067 P D -0.5569
1068 S D -0.5827
1069 S D -0.6608
1070 S D -0.7574
1071 L D -0.8944
1072 G D -1.1753
1073 T D -0.8990
1074 Q D -1.3473
1075 T D -1.2185
1076 Y D -0.9722
1077 I D -0.9903
1078 C D 0.0000
1079 N D -1.3922
1080 V D 0.0000
1081 N D -1.8578
1082 H D 0.0000
1083 K D -2.6647
1084 P D -1.7363
1085 S D -1.8894
1086 N D -2.4820
1087 T D -2.0674
1088 K D -2.5662
1089 V D -1.5076
1090 D D -2.5115
1091 K D -2.1161
1092 R D -2.7829
1093 V D 0.0000
1094 E D -2.6236
1095 P D -1.6420
1096 K D -1.2985
1097 S D -1.3539
1098 C D -0.8146
1099 D D -1.7839
1100 K D -2.0174
1101 T D -1.4100
1102 H D 0.0000
1103 T D -1.4119
1104 C D -1.3628
1105 P D -0.8467
1106 P D -0.6027
1107 C D -0.4499
1108 P D -0.6389
1109 A D 0.0000
1110 P D -0.8095
1111 E D -1.3498
1112 L D 0.0834
1113 L D 1.2578
1114 G D 0.0086
1115 G D -0.0088
1116 P D -0.0230
1117 S D 0.2956
1118 V D 0.0000
1119 F D 2.3392
1120 L D 0.0000
1121 F D 2.1527
1122 P D 0.5096
1123 P D 0.0000
1124 K D -1.8664
1125 P D -1.2001
1126 K D -0.8803
1127 D D -1.0690
1128 T D 0.0000
1129 L D 0.0000
1130 M D 0.7335
1131 I D 1.6201
1132 S D 0.1673
1133 R D -0.8119
1134 T D -0.4078
1135 P D 0.0000
1136 E D -0.7588
1137 V D 0.0000
1138 T D 1.0378
1139 C D 0.0000
1140 V D 0.8279
1141 V D 0.0000
1142 V D 0.5202
1143 D D -0.0939
1144 V D 0.0000
1145 S D -1.6548
1146 H D -2.2823
1147 E D -2.8147
1148 D D 0.0000
1149 P D -2.5501
1150 E D -3.2331
1151 V D 0.0000
1152 K D -2.6166
1153 F D 0.0000
1154 N D -1.1779
1155 W D 0.0000
1156 Y D -0.8715
1157 V D -0.8258
1158 D D -2.0354
1159 G D -0.6855
1160 V D 0.9314
1161 E D -0.1130
1162 V D 0.4631
1163 H D -1.1171
1164 N D -1.1472
1165 A D -1.1406
1166 K D -2.1906
1167 T D 0.0000
1168 K D -2.6087
1169 P D -2.4016
1170 R D -3.3679
1171 E D -3.1952
1172 E D -3.1764
1173 Q D -2.0043
1174 Y D -0.7517
1175 N D -0.5812
1176 S D -0.7798
1177 T D 0.0000
1178 Y D 0.0000
1179 R D -1.7541
1180 V D 0.0000
1181 V D -0.8878
1182 S D 0.0000
1183 V D 0.0141
1184 L D 0.0000
1185 T D -0.2295
1186 V D 0.5124
1187 L D 1.2039
1188 H D 0.0000
1189 Q D -0.8887
1190 D D -0.9023
1191 W D 0.0000
1192 L D -0.8650
1193 N D -1.9356
1194 G D -2.0085
1195 K D -2.1332
1196 E D -2.3237
1197 Y D 0.0000
1198 K D -1.6536
1199 C D 0.0000
1200 K D -1.5289
1201 V D 0.0000
1202 S D -1.4557
1203 N D -1.8965
1204 K D -2.0605
1205 A D -1.2585
1206 L D -0.6052
1207 P D -0.4970
1208 A D -0.3371
1209 P D -0.4868
1210 I D -0.4085
1211 E D -1.2175
1212 K D -0.8800
1213 T D -0.9083
1214 I D 0.1010
1215 S D -1.5522
1216 K D -1.5151
1217 A D -1.3793
1218 K D -2.3866
1219 G D -2.1594
1220 Q D -2.2521
1221 P D -2.4044
1222 R D -3.1665
1223 E D -3.0608
1224 P D 0.0000
1225 Q D -1.5726
1226 V D 0.0000
1227 Y D 0.0000
1228 T D 0.0000
1229 L D -0.1296
1230 P D -0.2280
1231 P D -0.8412
1232 S D -1.4717
1233 R D -2.6941
1234 E D -2.8291
1235 E D 0.0000
1236 M D -1.5487
1237 T D -1.4722
1238 K D -2.2635
1239 N D -2.6436
1240 Q D -2.6117
1241 V D 0.0000
1242 S D 0.0000
1243 L D 0.0000
1244 T D 0.0000
1245 C D 0.0000
1246 L D 0.0000
1247 V D 0.0000
1248 K D 0.0000
1249 G D -1.2725
1250 F D 0.0000
1251 Y D -1.4692
1252 P D 0.0000
1253 S D -0.0036
1254 D D -0.8182
1255 I D 0.0000
1256 A D -0.4539
1257 V D 0.0000
1258 E D -0.8984
1259 W D 0.0000
1260 E D -1.6895
1261 S D 0.0000
1262 N D -1.9845
1263 G D -1.7544
1264 Q D -2.1230
1265 P D -1.8426
1266 E D -2.0290
1267 N D -2.0214
1268 N D -1.7189
1269 Y D -1.0159
1270 K D -0.7750
1271 T D -0.4188
1272 T D 0.0000
1273 P D -0.0336
1274 P D 0.2269
1275 V D 0.5799
1276 L D 0.6660
1277 D D -0.6430
1278 S D -1.5203
1279 D D -2.0962
1280 G D -1.0161
1281 S D 0.0000
1282 F D 0.0408
1283 F D 0.0000
1284 L D 0.0000
1285 Y D 0.0000
1286 S D 0.0000
1287 K D 0.0000
1288 L D 0.0000
1289 T D -1.0141
1290 V D 0.0000
1291 D D -2.5434
1292 K D -2.3905
1293 S D -2.0158
1294 R D -2.1077
1295 W D -1.7819
1296 Q D -2.1383
1297 Q D -2.3101
1298 G D -1.1484
1299 N D -1.2239
1300 V D -0.3273
1301 F D 0.0000
1302 S D -1.0100
1303 C D 0.0000
1304 S D -0.6234
1305 V D 0.0000
1306 M D -0.5481
1307 H D 0.0000
1308 E D -1.2671
1309 A D -2.0421
1310 L D 0.0000
1311 H D -1.8643
1312 N D -1.7817
1313 H D -1.2739
1314 Y D -0.6430
1315 T D -1.0116
1316 Q D -1.0498
1317 K D -1.2866
1318 S D -0.4779
1319 L D 0.0000
1320 S D 0.3970
1321 L D 1.1991
1322 S D 0.3426
1323 P D -0.2445
1324 G D -0.1364

 

Laboratory of Theory of Biopolymers 2015