Project name: 1rf8_FULL_Valen

Status: done

submitted: 2018-10-09 15:56:29, status changed: 2018-10-09 16:11:15
Settings
Chain sequence(s) A: MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLCGKGADIDELWLCTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKCEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHCSANGRHPQPSITL
B: GSIGLEAEIETTTDETDDGTNTVSHILNVLKDATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKIVIPPGMGR
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5022
Maximal score value
1.6062
Average score
-0.9459
Total score value
-296.0711

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3666
2 S A 0.6873
3 V A 0.7724
4 E A -1.4708
5 E A -1.6581
6 V A -0.5874
7 S A -1.2838
8 K A -2.4404
9 K A -2.3837
10 F A -0.8527
11 E A -2.6591
12 E A -2.8061
13 N A -1.3963
14 V A 0.9563
15 S A 0.5519
16 V A 0.5944
17 D A -1.8768
18 D A -2.3350
19 T A -1.1432
20 T A -0.8907
21 A A -0.3068
22 T A -0.3347
23 P A -1.0628
24 K A -1.4313
25 T A 0.0000
26 V A 0.0000
27 L A 0.0000
28 S A -1.7351
29 D A -1.3291
30 S A -1.2798
31 A A -1.3059
32 H A -1.6708
33 F A 0.0000
34 D A -1.5205
35 V A 0.0000
36 K A 0.0000
37 H A 0.0000
38 P A 0.0000
39 L A 0.0000
40 N A -1.0772
41 T A 0.0000
42 K A -2.5152
43 W A 0.0000
44 T A 0.0000
45 L A 0.0000
46 W A 0.0000
47 Y A 0.0000
48 T A 0.0000
49 K A -1.9465
50 P A -1.7123
51 A A -0.8345
52 V A -0.8187
53 D A -2.7389
54 K A -2.4336
55 S A -2.1367
56 E A -2.7561
57 S A -1.9997
58 W A -1.3513
59 S A -1.6380
60 D A -2.7122
61 L A 0.0000
62 L A -1.7726
63 R A -2.5367
64 P A -1.1926
65 V A -0.4064
66 T A 0.0000
67 S A -0.1705
68 F A -0.3242
69 Q A -0.5622
70 T A 0.0000
71 V A 0.0000
72 E A 0.0000
73 E A 0.0000
74 F A 0.0000
75 W A 0.0000
76 A A 0.0000
77 I A 0.0000
78 I A 0.0000
79 Q A 0.0000
80 N A -0.9031
81 I A -0.3110
82 P A 0.0000
83 E A -1.1661
84 P A 0.0000
85 H A -1.9325
86 E A -1.8873
87 L A -0.8019
88 P A -1.2613
89 L A -1.8826
90 K A -2.6713
91 S A 0.0000
92 D A -1.1913
93 Y A 0.0000
94 H A 0.0000
95 V A 0.0000
96 F A 0.0000
97 R A -2.3511
98 N A -2.4005
99 D A -2.1799
100 V A -1.9484
101 R A -2.6907
102 P A -1.7892
103 E A -1.8935
104 W A -1.8247
105 E A -3.3797
106 D A -2.7513
107 E A 0.0000
108 A A 0.0000
109 N A -2.2899
110 A A -1.4462
111 K A 0.0000
112 G A -1.0314
113 G A 0.0000
114 K A 0.0000
115 W A 0.0000
116 S A 0.0000
117 F A 0.0000
118 Q A -0.7972
119 L A 0.0000
120 C A -0.4317
121 G A -1.2819
122 K A -1.8133
123 G A -1.9762
124 A A -1.6593
125 D A -2.0250
126 I A 0.0000
127 D A 0.0000
128 E A -0.7539
129 L A -0.3736
130 W A 0.0000
131 L A 0.0000
132 C A 0.1845
133 T A 0.0000
134 L A 0.0000
135 L A 0.0000
136 A A 0.0000
137 V A 0.0000
138 I A 0.0000
139 G A 0.0000
140 E A 0.0000
141 T A 0.0000
142 I A -1.4435
143 D A -2.5178
144 E A -3.0984
145 D A -1.4183
146 D A 0.0000
147 S A -1.8946
148 Q A -1.8641
149 I A 0.0000
150 N A 0.0000
151 G A 0.0000
152 V A 0.0000
153 V A 0.0000
154 L A 0.0000
155 S A -0.9503
156 I A 0.0000
157 R A -3.3819
158 K A -2.9080
159 G A -1.8390
160 G A 0.0000
161 N A 0.0000
162 K A -1.0966
163 F A 0.0000
164 A A 0.0000
165 L A 0.0000
166 W A 0.0000
167 T A 0.0000
168 K A -1.7741
169 C A -2.0077
170 E A -3.2519
171 D A -3.4972
172 K A -2.9985
173 E A -3.1255
174 P A -2.2951
175 L A 0.0000
176 L A -1.0008
177 R A -2.0611
178 I A -1.0649
179 G A 0.0000
180 G A -1.3350
181 K A -1.8485
182 F A 0.0000
183 K A -2.1451
184 Q A -2.4131
185 V A 0.0000
186 L A 0.0000
187 K A -1.8432
188 L A -1.7087
189 T A -1.9934
190 D A -2.7843
191 D A -2.7783
192 G A -1.4892
193 H A -1.1070
194 L A 0.0000
195 E A 0.0000
196 F A 0.0000
197 F A -0.0308
198 P A -0.5697
199 H A -1.4213
200 C A -0.5691
201 S A 0.0000
202 A A 0.0000
203 N A -3.1626
204 G A -2.4338
205 R A -3.2492
206 H A -2.5350
207 P A -1.8106
208 Q A -1.5564
209 P A -0.7471
210 S A 0.2792
211 I A 1.3126
212 T A 0.8030
213 L A 0.3706
215 G B -0.1621
216 S B 0.3400
217 I B 1.6062
218 G B 0.7076
219 L B 0.4462
220 E B -1.1297
221 A B -0.7881
222 E B -1.3729
223 I B 0.0303
224 E B -1.3334
225 T B -0.8049
226 T B -1.0205
227 T B -1.8002
228 D B -2.7605
229 E B -3.5022
230 T B -2.8375
231 D B -3.3540
232 D B -3.2701
233 G B -2.3258
234 T B -1.8133
235 N B -1.8550
236 T B -1.3582
237 V B 0.0000
238 S B -0.9443
239 H B -1.1288
240 I B 0.0000
241 L B 0.0000
242 N B -2.2668
243 V B 0.0000
244 L B 0.0000
245 K B -3.0379
246 D B -2.9248
247 A B -1.8908
248 T B -1.0471
249 P B -0.3146
250 I B 0.0000
251 E B -1.3378
252 D B 0.0000
253 V B 0.0000
254 F B -0.4842
255 S B -0.9554
256 F B -1.1306
257 N B -1.9718
258 Y B 0.0000
259 P B -2.0572
260 E B -2.5688
261 G B -1.5588
262 I B -1.5832
263 E B -2.5041
264 G B 0.0000
265 P B -1.2322
266 D B -1.6462
267 I B -0.4413
268 K B 0.0000
269 Y B -1.2127
270 K B -2.7691
271 K B -2.8076
272 E B -3.3920
273 H B -2.5330
274 V B -1.8837
275 K B -1.3631
276 Y B 0.0000
277 T B 0.0000
278 Y B 0.0000
279 G B 0.0000
280 P B 0.0764
281 T B 0.0179
282 F B 0.0000
283 L B 0.0000
284 L B -0.5470
285 Q B -0.9868
286 F B 0.0000
287 K B -1.4383
288 D B -2.4646
289 K B -1.9502
290 L B 0.0000
291 N B -2.1826
292 V B 0.0000
293 K B -2.4515
294 A B 0.0000
295 D B -2.2259
296 A B -1.0241
297 E B -1.3188
298 W B 0.0000
299 V B 0.6824
300 Q B -1.0840
301 S B 0.0000
302 T B 0.0000
303 A B 0.2946
304 S B -0.1209
305 K B 0.0000
306 I B 0.9494
307 V B 0.9442
308 I B 0.3627
309 P B -0.3931
310 P B -0.7857
311 G B -0.8569
312 M B -0.0457
313 G B -0.7595
314 R B -1.7812

 

Laboratory of Theory of Biopolymers 2015